KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03236Help
Entry
KNP414_03236      CDS       T01550                                 

Gene name
uao
Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KNP414_03236 (uao)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    KNP414_03236 (uao)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     KNP414_03236 (uao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3385220..3386254
Genome map
AA seq 344 aa AA seqDB search
MSRTETGKRTMYYGKGDVLVYRTFAEPLTEVTRIPESPFTGDGNVIMAMNVKVAVRGEAF
LTSFTEGDNSMVVATDSMKNLIIRHAADYEGSTVEGFLYHIAGIFLKKYSHITTIELEAD
RLPFDGLSVASPDGGWRESGLVFRRSHNDHTSASVVVERAEGGVLTVRKQESLLTGLQLI
KVKGSSFAGFIRDEYTTLPETQDRPLFIWLNIGWTYKDEKDAIDPKNGSYAASEQIRDIA
HTVFHEANSPSIQHLIYRIGLRILERFPQLAEVRFESNNRTWETVVESVDGSDARVYTEP
RPPYGFQGFSMTQEDLAAAAGGEDGEAAAALETAASERSEAPTS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggaaacgggcaaacgcacgatgtactatggaaaaggggatgtgctcgtc
taccgcacgttcgccgagccgctgaccgaggttacacgcattccggagtcgccgttcacg
ggggacggcaatgtcattatggcaatgaatgtcaaggtggcggtccggggggaggcgttc
ctgacctcgttcaccgaaggggacaattcgatggtcgtggccaccgattcgatgaaaaat
ctgatcatccgccacgccgccgactacgagggcagcaccgtcgaaggattcctgtaccac
atcgcgggcatcttcctgaagaagtattcgcatatcaccactattgaactggaagcggac
cgcctgcccttcgacggcctgagcgtggcttcgcccgacggaggctggagggagagcggc
ctcgtcttccgccggtcgcacaatgaccatacgtcggcttccgttgttgtggagcgtgcg
gagggcggagtcctcacggtgcggaagcaggagagcctgctgacgggtctgcagctcatc
aaggtcaaaggcagctccttcgccggcttcatccgcgacgagtacacgaccctgccggag
acgcaggaccgtccgctctttatctggctgaacatcggatggacgtataaggacgagaag
gatgcgatcgatccgaagaacggaagctacgccgcatcggagcagatccgggatattgcg
cacacggtgttccatgaagcgaactccccgtcgattcagcatctgatctaccggatcggg
ctgcgcatcctggagcggttcccgcagctggccgaggtgcgcttcgagtcgaacaaccgg
acctgggagacggtggtggagagtgtggacggctcggacgcaagagtctatacggagccg
cgcccgccgtacggcttccagggcttctcgatgacgcaggaggacctggccgccgccgca
gggggagaggacggcgaggcggcagcggcgctcgagaccgcagcatcggagcgttcggag
gctcccacctcatga

DBGET integrated database retrieval system