KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03236Help
Entry
KNP414_03236      CDS       T01550                                 

Gene name
uao
Definition
hypothetical protein
Organism
pms  Paenibacillus mucilaginosus KNP414
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3385220..3386254
Genome map
AA seq 344 aa AA seqDB search
MSRTETGKRTMYYGKGDVLVYRTFAEPLTEVTRIPESPFTGDGNVIMAMNVKVAVRGEAF
LTSFTEGDNSMVVATDSMKNLIIRHAADYEGSTVEGFLYHIAGIFLKKYSHITTIELEAD
RLPFDGLSVASPDGGWRESGLVFRRSHNDHTSASVVVERAEGGVLTVRKQESLLTGLQLI
KVKGSSFAGFIRDEYTTLPETQDRPLFIWLNIGWTYKDEKDAIDPKNGSYAASEQIRDIA
HTVFHEANSPSIQHLIYRIGLRILERFPQLAEVRFESNNRTWETVVESVDGSDARVYTEP
RPPYGFQGFSMTQEDLAAAAGGEDGEAAAALETAASERSEAPTS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggaaacgggcaaacgcacgatgtactatggaaaaggggatgtgctcgtc
taccgcacgttcgccgagccgctgaccgaggttacacgcattccggagtcgccgttcacg
ggggacggcaatgtcattatggcaatgaatgtcaaggtggcggtccggggggaggcgttc
ctgacctcgttcaccgaaggggacaattcgatggtcgtggccaccgattcgatgaaaaat
ctgatcatccgccacgccgccgactacgagggcagcaccgtcgaaggattcctgtaccac
atcgcgggcatcttcctgaagaagtattcgcatatcaccactattgaactggaagcggac
cgcctgcccttcgacggcctgagcgtggcttcgcccgacggaggctggagggagagcggc
ctcgtcttccgccggtcgcacaatgaccatacgtcggcttccgttgttgtggagcgtgcg
gagggcggagtcctcacggtgcggaagcaggagagcctgctgacgggtctgcagctcatc
aaggtcaaaggcagctccttcgccggcttcatccgcgacgagtacacgaccctgccggag
acgcaggaccgtccgctctttatctggctgaacatcggatggacgtataaggacgagaag
gatgcgatcgatccgaagaacggaagctacgccgcatcggagcagatccgggatattgcg
cacacggtgttccatgaagcgaactccccgtcgattcagcatctgatctaccggatcggg
ctgcgcatcctggagcggttcccgcagctggccgaggtgcgcttcgagtcgaacaaccgg
acctgggagacggtggtggagagtgtggacggctcggacgcaagagtctatacggagccg
cgcccgccgtacggcttccagggcttctcgatgacgcaggaggacctggccgccgccgca
gggggagaggacggcgaggcggcagcggcgctcgagaccgcagcatcggagcgttcggag
gctcccacctcatga

DBGET integrated database retrieval system