KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03246Help
Entry
KNP414_03246      CDS       T01550                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00020  Citrate cycle (TCA cycle)
pms00620  Pyruvate metabolism
pms00633  Nitrotoluene degradation
pms00640  Propanoate metabolism
pms00650  Butanoate metabolism
pms00680  Methane metabolism
pms01100  Metabolic pathways
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_03246
   00020 Citrate cycle (TCA cycle)
    KNP414_03246
   00620 Pyruvate metabolism
    KNP414_03246
   00640 Propanoate metabolism
    KNP414_03246
   00650 Butanoate metabolism
    KNP414_03246
  Energy metabolism
   00680 Methane metabolism
    KNP414_03246
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KNP414_03246
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     KNP414_03246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_16 Fer4_8 Fer4_9 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AEI41804
UniProt: F8FF86
Position
3395867..3396880
Genome map
AA seq 337 aa AA seqDB search
MRVLPKTNDLGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCDLNTNIRDTTPVERPHVVGVFHENLSKTVNVISGMYEDSLVLVNSPKSPAELKE
KLKLVGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCEFLDFEHMKGIIRKSLEKKYPGA
VEPALRTFQRGYDEVQFQTFSLPEGLEMPMPKRWDIPVYGYETQAIGGMVSNPGNSILKD
LSISRSGMMPHFDEEKCIHCAACDTACPDFCFVWDEAADKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTSNRETDGYGEAHRIPHRFRLAAKSV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttaccgaaaacgaatgacctcggtttcttcgaaatccgactcgagtccatc
ggcggcctgggtgcaaacctggcaggcaaaatgctggccgaagcgggcgtcgtcgggagc
gggtttaacggtgtcagcttctcttcctacgggtccgagaaaaagggatcgcccgttaag
gcacatatccggttctgtgatctgaacacgaacatccgggacacgacgcccgtggagcgg
ccgcatgtcgttggcgtgttccacgagaatctgtcgaagaccgtgaacgtgatcagcggc
atgtatgaggacagtctcgtgctcgtcaactcgcccaagagtccggcggagctgaaggag
aagctgaagctggtcggcggtacgatcgccgtggtcgatgcaacgggcatcgcgctcgag
gagaagaaccgggtcaacatggccatgctcggcggtctgtttcggctctgtgagttcctt
gattttgaacacatgaaaggcatcatccgcaagtccctggagaaaaaataccccggcgcc
gtcgagcccgccctgcggacgttccagcgcggatacgatgaagtgcagttccagaccttc
tcgctgcccgaaggcctcgagatgccgatgccgaagcggtgggatatcccggtatacggc
tatgagacgcaggcgatcggcgggatggtgtccaaccccggcaactcgatcctcaaagac
ctgagcatctcgcgcagcgggatgatgcctcacttcgatgaagaaaaatgcattcactgc
gccgcctgtgatacggcctgtcccgacttctgcttcgtatgggacgaggccgccgacaag
aaaggccgtccgcagatgttcctgcagggcattgactaccagtactgcaagggctgtctg
aagtgtgtggtggcctgtccgactgaagcgcttacatccaatcgggagacggacggctat
ggggaagcccaccgcattccgcaccggttccggctcgcagcgaagtccgtataa

DBGET integrated database retrieval system