KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03246Help
Entry
KNP414_03246      CDS       T01550                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KNP414_03246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_03246
   00020 Citrate cycle (TCA cycle)
    KNP414_03246
   00620 Pyruvate metabolism
    KNP414_03246
   00640 Propanoate metabolism
    KNP414_03246
   00650 Butanoate metabolism
    KNP414_03246
  Energy metabolism
   00680 Methane metabolism
    KNP414_03246
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KNP414_03246
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     KNP414_03246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3395867..3396880
Genome map
AA seq 337 aa AA seqDB search
MRVLPKTNDLGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCDLNTNIRDTTPVERPHVVGVFHENLSKTVNVISGMYEDSLVLVNSPKSPAELKE
KLKLVGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCEFLDFEHMKGIIRKSLEKKYPGA
VEPALRTFQRGYDEVQFQTFSLPEGLEMPMPKRWDIPVYGYETQAIGGMVSNPGNSILKD
LSISRSGMMPHFDEEKCIHCAACDTACPDFCFVWDEAADKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTSNRETDGYGEAHRIPHRFRLAAKSV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttaccgaaaacgaatgacctcggtttcttcgaaatccgactcgagtccatc
ggcggcctgggtgcaaacctggcaggcaaaatgctggccgaagcgggcgtcgtcgggagc
gggtttaacggtgtcagcttctcttcctacgggtccgagaaaaagggatcgcccgttaag
gcacatatccggttctgtgatctgaacacgaacatccgggacacgacgcccgtggagcgg
ccgcatgtcgttggcgtgttccacgagaatctgtcgaagaccgtgaacgtgatcagcggc
atgtatgaggacagtctcgtgctcgtcaactcgcccaagagtccggcggagctgaaggag
aagctgaagctggtcggcggtacgatcgccgtggtcgatgcaacgggcatcgcgctcgag
gagaagaaccgggtcaacatggccatgctcggcggtctgtttcggctctgtgagttcctt
gattttgaacacatgaaaggcatcatccgcaagtccctggagaaaaaataccccggcgcc
gtcgagcccgccctgcggacgttccagcgcggatacgatgaagtgcagttccagaccttc
tcgctgcccgaaggcctcgagatgccgatgccgaagcggtgggatatcccggtatacggc
tatgagacgcaggcgatcggcgggatggtgtccaaccccggcaactcgatcctcaaagac
ctgagcatctcgcgcagcgggatgatgcctcacttcgatgaagaaaaatgcattcactgc
gccgcctgtgatacggcctgtcccgacttctgcttcgtatgggacgaggccgccgacaag
aaaggccgtccgcagatgttcctgcagggcattgactaccagtactgcaagggctgtctg
aagtgtgtggtggcctgtccgactgaagcgcttacatccaatcgggagacggacggctat
ggggaagcccaccgcattccgcaccggttccggctcgcagcgaagtccgtataa

DBGET integrated database retrieval system