KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03393Help
Entry
KNP414_03393      CDS       T01550                                 

Definition
hypothetical protein
Organism
pms  Paenibacillus mucilaginosus KNP414
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3523206..3523751)
Genome map
AA seq 181 aa AA seqDB search
MRMHVALNVRNLEATLSFYTKLFHAEPAKVKENYAKFELDEPPLHFSLNVRPYADQGVLN
HLGFQVSRKEDVLAAKERLESAGLFSVDEMDTTCCYAVQDKIWVTDPEGNAWEVFYTKAD
AEFESADARSLPSPSVCCTPIPQEKEPAAEAAASPGCCADSLRAPQEASAPSVGGSCGCS
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcatgtcgcgcttaacgtcaggaatctggaggccaccctttcattctacacc
aaactgttccatgcggagccggccaaagtcaaagagaactatgccaagtttgaactggat
gagccgccccttcacttctccttgaacgtccgtccgtatgcggatcagggggtgctcaac
caccttggattccaggtcagccgtaaggaagatgtgctcgccgccaaagaaagactagag
agcgccgggctgttctctgtcgatgagatggatacgacctgctgctatgccgtacaggat
aaaatttgggtcacggacccggaaggcaacgcctgggaagtcttctacaccaaagcggat
gccgaattcgagtcggcggacgctcgttcccttccctcaccctccgtatgctgcactccg
atcccccaggagaaggagccggccgctgaagctgcggcttcccccggttgctgtgccgat
tccctgcgagctccacaggaagcctctgcaccgtcggttgggggcagctgcggctgttcc
cgataa

DBGET integrated database retrieval system