KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03453Help
Entry
KNP414_03453      CDS       T01550                                 

Gene name
cypD
Definition
protein CypD
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    KNP414_03453 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    KNP414_03453 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KNP414_03453 (cypD)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KNP414_03453 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     KNP414_03453 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3589923..3593108
Genome map
AA seq 1061 aa AA seqDB search
MTQTSQIPQPKTFGPLGNLPNLNTKEPVQSIVKIADEFGPIFQLDLPRGKSVYISSHELV
ADACDESRFDKYVWAPLQKVRAFAGDGLFTAETDEPNWQKAHAILLPSFSQRAMQGYHAM
MVDLAVQLVQKWARLNPDESVEVGEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMV
RALDEAMSQLQRLGLQDKLMVISKRQYKHDIQTMFGLVDKIIAERKEHGPKDGEDLLAHM
LNGRDPHTGEALDDENIRYQIITFLIAGHETTSGLLTFALYFLLKNPEKLAKAYEEVDRV
LTSPLPTYSQVRELKYIRMILNESLRLWPTAPAFALTAKEDTMLGGRYPMKKGDSVSVLI
PKLHRDPSVWGDDVESFIPERFEDPSSIPPHAYKPFGNGQRACIGQQFALHEAVLVLGMV
LRHFEIIDHTNYQLKIKETLTLKPEGFTMRVRSRIEPQAVVMPGREAAPLEEKREQAAEA
APVPKHNTPLLVLYGSNLGTAEGIARELADAARYQGFSSETAPLDEHVGSLPKEGAVFIV
TASYNGSPPDNARAFVQWLEQAEPGSLDGVRYAVFGCGDHNWASTYQQVPRKIDALLADK
GAKRLAGLGEGDVSDDFEQQLESWRGGLWPQVMEAFGLSLNENAGQERSSLTVQFVSGLI
GTPLAESYDALQTTVAENRELQGEGSDRSTRHIEVVLPEEVSYREGDHLGVLPLNPKDLV
GRVLQRFGLQGGDHLVLSATGRSAAHLPLDRPVRLSDLLGSSVELQEPATRAQLRELAAY
TVCPPHKRELEALLQEDAYKTEVLRKRVTMLELLEKYPACELPFERFLELLPPLKARYYS
ISSSPRVLGDRVSITVSVVRGPAWSGRGEYRGIASNYLAERKPGDPVVVFVRSPESGFEL
PEDPSTPVIMVGPGTGVAPFRGFLQARRVLQAQGAELGEAHLYFGCRNPQHDYLYREELE
QAEKDGLVVLHTACSRVDGQEKTYVQDLMKGDASLLIGLLDRGGKLYICGDGSRMAPDVE
ATLRRAYSEIHGVSGQEAADWLDGLARENRYAKDVWAGTAG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccagtcaaattccgcagcccaaaacgttcggaccgctcggcaacctgccg
aatttgaatacgaaggagccggtgcagtccattgtcaaaatagcggacgagttcggtccg
atcttccagctggacctgcccagaggcaagtcagtgtacatctcgagccatgaactggtg
gctgatgcgtgtgacgagtcgcggttcgacaagtatgtgtgggcgccgcttcagaaagta
agggcgttcgcgggggacgggctcttcacggccgagacggatgagccgaactggcagaag
gcccatgccattctgctgccaagcttctcgcagcgggcgatgcagggctaccatgcgatg
atggtggatctcgcggttcagctcgtccagaagtgggcgaggctcaatccggacgaaagc
gtcgaggtcggtgaggacatgacgcgccttacgctcgatacgatcggcctctgcggcttc
aactaccgcttcaacagcttttaccgggatcagccgcatccgttcatcacttcgatggtg
cgggcgctcgacgaagcgatgagccagctgcagcggcttggcctccaggacaagctcatg
gtgatctccaagcggcagtacaagcacgacatccagacgatgttcgggctcgtggacaaa
atcatcgcggagcgcaaggagcacggaccgaaggatggcgaggatctgctcgcgcatatg
ctcaacgggcgcgacccgcacacaggcgaggcgcttgacgatgagaacatccggtaccag
attatcacgttcctgatcgccggacatgagacgacaagcggtctgctgacgttcgccctg
tatttccttctgaagaatccggagaagctcgccaaggcctacgaggaggtcgaccgggtg
cttacgagcccgttgccaacctacagccaggtgcgtgagctgaagtacatccgcatgatc
ctgaacgagtcgctgcgcctgtggcctacggcccctgccttcgcgctgacggccaaggaa
gatacgatgctgggcggccggtacccgatgaaaaaaggggacagcgtctcggtcctcatt
ccgaagctgcaccgcgatccttccgtctggggcgatgatgtcgagtccttcatcccggag
cggttcgaggacccgtcgagcattccgccccatgcctacaagccgttcggcaacggacag
cgggcctgcatcgggcagcagttcgcgctgcacgaagcggtgctggtgctggggatggtg
ctgcgccacttcgagattatcgaccatacgaattaccagctcaaaatcaaagaaacgctg
acgctgaagccggagggcttcacgatgcgggtgcgttcgcgcattgagccgcaggcggtg
gtgatgccgggccgggaggcggcgccgctggaggagaagcgggagcaggccgccgaggcc
gctccggtgccgaagcacaacacgccgctgcttgtgctctacggctcgaatctcgggacg
gccgaaggcatcgcccgggagctcgccgatgcggcccgctatcagggcttctcgagcgag
accgctccactcgatgaacatgtcggcagcctgccgaaggagggggcggtcttcatcgtg
accgcctcgtacaacggcagcccgccggacaatgcccgcgcgttcgtgcagtggctcgag
caggcggagcccggctcgctggatggcgtccgttacgccgttttcggctgcggggatcac
aactgggcgagcacgtaccagcaggtgccgcggaagatcgacgcgctgctcgcggacaaa
ggggcgaagcgtcttgccggcctgggcgaaggcgatgtcagcgacgatttcgagcagcag
ctggagtcctggcgcggcggcttgtggccgcaggtgatggaggcgttcggcctgtcgctg
aacgagaatgcaggccaagagcgcagctcccttaccgtgcagttcgtcagcggcctgatc
ggcacgccgctggccgaatcgtacgatgcgctgcagacgaccgtcgcggagaaccgcgag
ctgcagggggaaggcagcgaccgcagcacgcggcacatcgaggtggtgctgcctgaagag
gtgagctaccgcgaaggcgaccacctcggtgtgctgccgctgaacccgaaggacctcgtg
ggacgggtgctgcagcgcttcggcctgcagggcggcgaccacctcgtgctgagcgcgacc
ggacgcagtgcggcgcacctgccgctggaccggccggtgcggctgtccgacctgctcggg
agcagcgtggagctgcaggagccggcgacccgggcccagctgcgcgagcttgctgcctac
acggtgtgcccgccgcataagcgggagctcgaggcgctgctgcaggaggacgcctacaag
accgaggtgctgcgcaagcgggtgaccatgctggagctgctcgagaaatacccggcctgc
gagctgccgttcgagcggtttctcgagctgctgccgccgctgaaggcgcgttattactcg
atctccagctcgccgcgcgtgctgggagaccgcgtcagcatcacggtcagcgtcgtgcgc
ggcccggcctggagcggccggggtgaataccgcggcatcgcctcgaactacctcgccgag
cggaagccgggcgacccggtggtcgtgttcgtccgctcgccggagtcgggcttcgagctg
ccggaggacccgtcgacgccggtgatcatggtcggcccgggtaccggggtggcgccgttc
cgcggcttcctgcaggcccgccgcgtcctgcaggctcagggcgccgagctcggcgaggcc
cacctgtacttcggctgccgcaacccgcagcacgattacctctaccgcgaggagctcgag
caggcggagaaggacgggctggtcgtcctgcatacggcatgctcccgcgtggatgggcag
gagaaaacctacgtgcaggatctcatgaaaggcgacgcctcgctgctgatcgggctgctg
gaccggggcggcaagctgtacatctgcggcgacggcagccggatggcccccgacgtggaa
gcgaccctgcgccgcgcgtacagcgagattcacggcgtaagcgggcaggaggcagcggac
tggcttgacgggctcgcccgcgagaaccgctacgccaaggacgtgtgggccggaacggca
ggctga

DBGET integrated database retrieval system