KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03453Help
Entry
KNP414_03453      CDS       T01550                                 

Gene name
cypD
Definition
protein CypD
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pms00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pms00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pms00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3589923..3593108
Genome map
AA seq 1061 aa AA seqDB search
MTQTSQIPQPKTFGPLGNLPNLNTKEPVQSIVKIADEFGPIFQLDLPRGKSVYISSHELV
ADACDESRFDKYVWAPLQKVRAFAGDGLFTAETDEPNWQKAHAILLPSFSQRAMQGYHAM
MVDLAVQLVQKWARLNPDESVEVGEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMV
RALDEAMSQLQRLGLQDKLMVISKRQYKHDIQTMFGLVDKIIAERKEHGPKDGEDLLAHM
LNGRDPHTGEALDDENIRYQIITFLIAGHETTSGLLTFALYFLLKNPEKLAKAYEEVDRV
LTSPLPTYSQVRELKYIRMILNESLRLWPTAPAFALTAKEDTMLGGRYPMKKGDSVSVLI
PKLHRDPSVWGDDVESFIPERFEDPSSIPPHAYKPFGNGQRACIGQQFALHEAVLVLGMV
LRHFEIIDHTNYQLKIKETLTLKPEGFTMRVRSRIEPQAVVMPGREAAPLEEKREQAAEA
APVPKHNTPLLVLYGSNLGTAEGIARELADAARYQGFSSETAPLDEHVGSLPKEGAVFIV
TASYNGSPPDNARAFVQWLEQAEPGSLDGVRYAVFGCGDHNWASTYQQVPRKIDALLADK
GAKRLAGLGEGDVSDDFEQQLESWRGGLWPQVMEAFGLSLNENAGQERSSLTVQFVSGLI
GTPLAESYDALQTTVAENRELQGEGSDRSTRHIEVVLPEEVSYREGDHLGVLPLNPKDLV
GRVLQRFGLQGGDHLVLSATGRSAAHLPLDRPVRLSDLLGSSVELQEPATRAQLRELAAY
TVCPPHKRELEALLQEDAYKTEVLRKRVTMLELLEKYPACELPFERFLELLPPLKARYYS
ISSSPRVLGDRVSITVSVVRGPAWSGRGEYRGIASNYLAERKPGDPVVVFVRSPESGFEL
PEDPSTPVIMVGPGTGVAPFRGFLQARRVLQAQGAELGEAHLYFGCRNPQHDYLYREELE
QAEKDGLVVLHTACSRVDGQEKTYVQDLMKGDASLLIGLLDRGGKLYICGDGSRMAPDVE
ATLRRAYSEIHGVSGQEAADWLDGLARENRYAKDVWAGTAG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccagtcaaattccgcagcccaaaacgttcggaccgctcggcaacctgccg
aatttgaatacgaaggagccggtgcagtccattgtcaaaatagcggacgagttcggtccg
atcttccagctggacctgcccagaggcaagtcagtgtacatctcgagccatgaactggtg
gctgatgcgtgtgacgagtcgcggttcgacaagtatgtgtgggcgccgcttcagaaagta
agggcgttcgcgggggacgggctcttcacggccgagacggatgagccgaactggcagaag
gcccatgccattctgctgccaagcttctcgcagcgggcgatgcagggctaccatgcgatg
atggtggatctcgcggttcagctcgtccagaagtgggcgaggctcaatccggacgaaagc
gtcgaggtcggtgaggacatgacgcgccttacgctcgatacgatcggcctctgcggcttc
aactaccgcttcaacagcttttaccgggatcagccgcatccgttcatcacttcgatggtg
cgggcgctcgacgaagcgatgagccagctgcagcggcttggcctccaggacaagctcatg
gtgatctccaagcggcagtacaagcacgacatccagacgatgttcgggctcgtggacaaa
atcatcgcggagcgcaaggagcacggaccgaaggatggcgaggatctgctcgcgcatatg
ctcaacgggcgcgacccgcacacaggcgaggcgcttgacgatgagaacatccggtaccag
attatcacgttcctgatcgccggacatgagacgacaagcggtctgctgacgttcgccctg
tatttccttctgaagaatccggagaagctcgccaaggcctacgaggaggtcgaccgggtg
cttacgagcccgttgccaacctacagccaggtgcgtgagctgaagtacatccgcatgatc
ctgaacgagtcgctgcgcctgtggcctacggcccctgccttcgcgctgacggccaaggaa
gatacgatgctgggcggccggtacccgatgaaaaaaggggacagcgtctcggtcctcatt
ccgaagctgcaccgcgatccttccgtctggggcgatgatgtcgagtccttcatcccggag
cggttcgaggacccgtcgagcattccgccccatgcctacaagccgttcggcaacggacag
cgggcctgcatcgggcagcagttcgcgctgcacgaagcggtgctggtgctggggatggtg
ctgcgccacttcgagattatcgaccatacgaattaccagctcaaaatcaaagaaacgctg
acgctgaagccggagggcttcacgatgcgggtgcgttcgcgcattgagccgcaggcggtg
gtgatgccgggccgggaggcggcgccgctggaggagaagcgggagcaggccgccgaggcc
gctccggtgccgaagcacaacacgccgctgcttgtgctctacggctcgaatctcgggacg
gccgaaggcatcgcccgggagctcgccgatgcggcccgctatcagggcttctcgagcgag
accgctccactcgatgaacatgtcggcagcctgccgaaggagggggcggtcttcatcgtg
accgcctcgtacaacggcagcccgccggacaatgcccgcgcgttcgtgcagtggctcgag
caggcggagcccggctcgctggatggcgtccgttacgccgttttcggctgcggggatcac
aactgggcgagcacgtaccagcaggtgccgcggaagatcgacgcgctgctcgcggacaaa
ggggcgaagcgtcttgccggcctgggcgaaggcgatgtcagcgacgatttcgagcagcag
ctggagtcctggcgcggcggcttgtggccgcaggtgatggaggcgttcggcctgtcgctg
aacgagaatgcaggccaagagcgcagctcccttaccgtgcagttcgtcagcggcctgatc
ggcacgccgctggccgaatcgtacgatgcgctgcagacgaccgtcgcggagaaccgcgag
ctgcagggggaaggcagcgaccgcagcacgcggcacatcgaggtggtgctgcctgaagag
gtgagctaccgcgaaggcgaccacctcggtgtgctgccgctgaacccgaaggacctcgtg
ggacgggtgctgcagcgcttcggcctgcagggcggcgaccacctcgtgctgagcgcgacc
ggacgcagtgcggcgcacctgccgctggaccggccggtgcggctgtccgacctgctcggg
agcagcgtggagctgcaggagccggcgacccgggcccagctgcgcgagcttgctgcctac
acggtgtgcccgccgcataagcgggagctcgaggcgctgctgcaggaggacgcctacaag
accgaggtgctgcgcaagcgggtgaccatgctggagctgctcgagaaatacccggcctgc
gagctgccgttcgagcggtttctcgagctgctgccgccgctgaaggcgcgttattactcg
atctccagctcgccgcgcgtgctgggagaccgcgtcagcatcacggtcagcgtcgtgcgc
ggcccggcctggagcggccggggtgaataccgcggcatcgcctcgaactacctcgccgag
cggaagccgggcgacccggtggtcgtgttcgtccgctcgccggagtcgggcttcgagctg
ccggaggacccgtcgacgccggtgatcatggtcggcccgggtaccggggtggcgccgttc
cgcggcttcctgcaggcccgccgcgtcctgcaggctcagggcgccgagctcggcgaggcc
cacctgtacttcggctgccgcaacccgcagcacgattacctctaccgcgaggagctcgag
caggcggagaaggacgggctggtcgtcctgcatacggcatgctcccgcgtggatgggcag
gagaaaacctacgtgcaggatctcatgaaaggcgacgcctcgctgctgatcgggctgctg
gaccggggcggcaagctgtacatctgcggcgacggcagccggatggcccccgacgtggaa
gcgaccctgcgccgcgcgtacagcgagattcacggcgtaagcgggcaggaggcagcggac
tggcttgacgggctcgcccgcgagaaccgctacgccaaggacgtgtgggccggaacggca
ggctga

DBGET integrated database retrieval system