KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03480Help
Entry
KNP414_03480      CDS       T01550                                 

Gene name
xynB
Definition
protein XynB
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pms  Paenibacillus mucilaginosus KNP414
Brite
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     KNP414_03480 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3625753..3626769
Genome map
AA seq 338 aa AA seqDB search
MEQRRQDQITVIPSLKEVYADRFAIGAAVSPQTIVTQKELLAAHYGSLTAENEMKPVSVQ
PEEGRFTFEDADRIARFAEEHGMQMRGHTLVWHNQTPDWMFVDGQGQPAGRDLVLQRMKD
HIGAVVGRYKDRIKVWDVVNEAVSDEGPQLLRPSKWLETAGEEFIRRAFEYAHEADPDAL
LFYNDYNECHPDKRDRIHRLLKSLKEQGTPVHGMGMQGHWSLQRPSADEIRAAVELYASL
DLQLHITELDVSVFEWDDKRTDLLEPTAEMLEAQERRYEEIFGLLREYSGVITSVTFWGA
ADDYTWLDHFPVRSRKNWPFLFDMNHQPKGSFWKVARL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaggcggcaggatcagatcaccgtgattccctctctgaaggaggtatatgcg
gaccggtttgcaatcggtgcggcggtgagtccgcagacgatcgtaacgcagaaggagctg
ctggcggcgcactatggcagccttacggcggagaacgagatgaagccggtctccgtccag
ccggaggaaggacggttcacgttcgaagacgcggaccggatcgcccggtttgctgaggag
catgggatgcagatgcgcgggcatacgctcgtctggcacaaccagacgcccgattggatg
ttcgtggacggccagggacagccagccggcagggacctcgtgcttcagcggatgaaggac
catatcggtgccgtagtcggccgttataaggaccgcatcaaggtgtgggacgtcgtcaac
gaggcggtatcggacgaggggccgcagcttctgcgcccgtcgaagtggctggagacggcg
ggagaggaattcatccgcagggcgttcgagtatgcgcatgaggcggacccggatgcgctt
ctgttctacaacgattacaacgagtgccatccggacaaaagggaccgcatccaccggctg
ctgaagtccctgaaggagcagggaacaccggtccacggcatgggcatgcagggccactgg
agcctgcagcgcccgtccgcggacgagatccgggcggcggtggagctgtatgcctcgctg
gacctgcagctgcatatcacggagctcgacgtgtcggtattcgagtgggacgacaagcgg
acggacctgctggagccgacggccgagatgctggaagcccaggagcgcaggtacgaagag
atcttcggtctgctgcgggagtacagcggggtcatcacctccgtgacgttctggggagcc
gccgacgattatacgtggctcgatcattttccggtgaggagccgcaagaactggccgttc
ctcttcgatatgaaccatcagccgaagggctccttttggaaggtggctcggctgtag

DBGET integrated database retrieval system