KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03493Help
Entry
KNP414_03493      CDS       T01550                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KNP414_03493
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_03493
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KNP414_03493
Enzymes [BR:pms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KNP414_03493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3639824..3641119
Genome map
AA seq 431 aa AA seqDB search
MHLQPRLHTAEEMGAIYLVYKEWKVFFMSRYSYFSHLQCPQCGLIFSGSEVRQLCGCGSP
LLARYDLEALRQVLPRPELEGRETSLWRYHELLPVERPENVVTLGEGMTPLLPLPRLGAA
YDLPHLYMKDEGIIPTGSFKARGATVGLSKAKELGVRQFAMPTNGNAGAAWSLYAARAGI
RASVVMPVDAPMITRGECAASGADLYLVNGLISDAGRLVAGKIASGGIYDASTLKEPYRI
EGKKTMGIEIAEQFGWTLPDVILYPTGGGVGLIGIYKALSELLELGWIEGPLPRLVAVQA
AGCAPIVKAWQEGASRSEFWPNSGTAAFGINVPKALGDFLVLEAVYATGGCAVAVEDEAL
LSEQRLAASLEGAFVCPEGAAAFAAARKLRESGWIRDGERVVVLNTGMGIKYPETIPVNA
PVLQPEDALPS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgcatctgcagcccaggctgcacacagcggaagagatgggggctatttatttggtttac
aaagaatggaaggtgttcttcatgtcccgttacagttacttctctcatctgcagtgtccc
caatgcggactgatcttctcgggctcggaagtgcggcagctgtgcggatgcggttctccg
ctgctcgcccgctacgatttggaggcgctgaggcaggttctgccccggcccgaactggag
ggaagagagaccagtctttggcgctaccatgaactgcttccggtagagcgtccggagaac
gtggtcacgcttggggaaggaatgaccccgctactccccctgcccaggctcggggcggcg
tatgacctcccccatctttatatgaaagacgaggggatcatccctaccggctcattcaag
gccaggggggcgaccgtcggcctgtcgaaggcgaaggagctgggggtccggcagttcgcc
atgccgacgaacggcaatgccggggcggcctggtccctgtacgcggcccgcgcgggcatc
cgggcgtcggtcgtcatgccggtcgatgcgccgatgattacgcggggcgaatgcgccgct
tccggagccgacctctacctcgtcaacgggctgatcagcgacgccggacggctcgtggcc
ggtaagatcgcctccggcggcatctatgatgcctctacccttaaggagccctaccgcatc
gaaggcaaaaagacgatgggcatcgagatcgccgagcagttcggctggactctgccggac
gtcattctctatccgaccggaggcggcgtcggtctcatcggcatctacaaagcgctcagc
gagctgctggagctcggctggatcgaagggccgctgccccggctggtggccgttcaggcg
gcaggctgcgcgcccatcgtgaaggcctggcaggaaggagcctcccgctcggagttctgg
ccgaactccggtacggccgccttcggcattaatgtgccgaaggcgctcggcgacttccta
gtgctggaggccgtttacgccaccggtggctgcgctgtcgcagtggaagacgaagccctg
ctgagcgagcagcgtctggcggcatcgctggaaggcgcattcgtctgccctgaaggcgcg
gctgccttcgcagcggcccggaagctgcgcgagagcggatggattcgggacggggagcgg
gtggtcgtcctgaatacgggcatgggcatcaagtatccggagacgatacctgtgaatgcc
cccgtacttcagccggaggatgcgctcccgtcatga

DBGET integrated database retrieval system