KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03882Help
Entry
KNP414_03882      CDS       T01550                                 

Gene name
gtaB2
Definition
protein GtaB2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pms00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pms00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pms00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pms00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4030856..4031731)
Genome map
AA seq 291 aa AA seqDB search
MRVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAMASGIEDIMIITGRNK
RAIEDHFDKSAELETLLEMNGKDELLELVQSVSNLADVHYIRQKQPLGLGHAVLCARKFI
GDEPFAVLLGDDIIQSEPPCLKQMMDLHEQTHASVIGCQEVPWDEVDKYGIISPASGGQG
AAAWRPIEDLVEKPERDAAPSNLAVIGRYILTPDIFGILEDSVPGRGGEIQLTDALRILN
RYQQMAAFPVPGRRFDVGDKLGYIEATIEMALQREELREPLLEYLQRRING
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagagtccgaaaagcaatcataccggccgcgggtctcggcacccgcttcctgccggca
acgaaggcgcagcccaaggagatgctgccgatcgtcgacaagccggcgattcaatatatc
gtagaggaagcgatggcgtcggggattgaggatatcatgatcatcaccggccgcaacaaa
cgggcgatcgaggaccatttcgacaagtcggcggagctggagacgctgctggagatgaac
ggcaaggacgagctgctggagctcgtgcagtccgtatcgaatctggcggatgtccactat
atccgccagaagcagccgctcgggctcgggcatgccgtgctctgcgcccgcaaattcatc
ggcgacgagccgttcgccgtgctcctcggcgacgatatcatccagtcggagccgccgtgc
ttgaagcagatgatggacctgcatgagcaaactcacgcctcggtcatcggctgtcaggaa
gtgccgtgggatgaggtcgacaagtacggtatcatctcgccggcttccggcggtcagggg
gcagccgcctggcgcccgatcgaggatctcgtggagaagccggagagggatgccgctccg
tcgaatctcgcggtcatcgggcgctacatcctgacgccggacatcttcggcattctcgag
gacagtgtgccgggccgcggcggagagatccagctgaccgacgcgctgcgcatcctgaac
cgctaccagcagatggcggccttcccggtcccgggacggcgcttcgacgtcggcgacaag
ctcggctacatcgaggcgaccattgagatggcgctgcagcgggaggagctgcgggaaccg
ctgctcgagtaccttcagcgccgcatcaacgggtag

DBGET integrated database retrieval system