KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03909Help
Entry
KNP414_03909      CDS       T01550                                 

Gene name
acsA
Definition
(GenBank) AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00620  Pyruvate metabolism
pms00640  Propanoate metabolism
pms00680  Methane metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_03909 (acsA)
   00620 Pyruvate metabolism
    KNP414_03909 (acsA)
   00640 Propanoate metabolism
    KNP414_03909 (acsA)
  Energy metabolism
   00680 Methane metabolism
    KNP414_03909 (acsA)
Enzymes [BR:pms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KNP414_03909 (acsA)
Lipid biosynthesis proteins [BR:pms01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KNP414_03909 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI42447
UniProt: F8F8Z9
Position
complement(4060032..4061756)
Genome map
AA seq 574 aa AA seqDB search
MDQTNVESIAPVTAQSNMKNYEEERAGFRWEDVEATFSWSQTGKLNAAYEAIDRHAESSR
RDKVALYYSDDRRDEQYTYLEMKQQSNRFGNVLKGLGVGKGDRVFIFMPRTPELYFALLG
AIKVGAVVGPLFEAFMETAVRDRLEDSEAVAIVTTPSQLSRVPVDQLPHLKHVILVGEDL
TLEAGQVDFRKEMESASDELELEWLDREDGLLIHYTSGSTGKPKGVFHVHNAMLQHYYTG
RVVLDLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPQDWYRTIERYGVT
VWYSAPTAFRMLMGAGDDAVKQFNLGSLRHVLSVGEPLNPEVVRWGLKVYNQRIHDTWWM
TETGGQLICNYPCMAIRPGSMGKPLPGIEAAIIDDSGNVLPPYRMGNLAIKTPWPSMMRK
IWKNPAKYEEYFRIQGWYISGDSAYMDEDGYFWFQGRIDDVINTAGERVGPFEVESKLVE
HPAVAEAGVIGKPDPMRGEIIKAFIALREGYTPSDELKADISRFVKEGLSAHAAPREIEF
KDKLPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacgaatgtggaaagcattgcacctgtaacggcacaatccaacatgaagaac
tatgaagaggaacgcgcgggcttccgctgggaagacgtagaggcgacattctcctggtcg
cagaccggaaagctgaacgcggcctacgaggcgatcgaccggcatgccgaatcgtcccgc
cgggacaaagtcgccctgtactacagtgatgaccgccgcgatgaacaatatacatatctc
gagatgaagcagcagtcgaaccgattcggcaacgtgctcaagggactgggtgtcggcaaa
ggggaccgggtcttcatcttcatgccccggacgccggagctttattttgcgctgctcggg
gcgatcaaagtcggagcggtggtcggtccgctgttcgaggcgttcatggaaacggccgtg
cgcgaccggctggaggacagcgaagcggtcgcgattgtcacgaccccgtcgcagctgtcc
cgtgtccctgtggatcagctgcctcatctgaagcatgtgatcctggttggcgaagacctg
acgctcgaggccggccaagtcgatttccgcaaggaaatggagagtgcttccgacgagctg
gagctggaatggctggaccgggaggacggcctgctcatccactatacgtcgggctcgaca
ggcaagccgaagggtgtcttccatgtgcataacgcgatgctgcagcactactatacgggc
cgtgtcgtgctggatctgcaggaagacgacgtgtattggtgtacggcggacccgggctgg
gtgacggggacatcgtacggcatcttcgctccttggctgaacggggcgacgaacgtcatc
cgggggggccgcttttccccgcaggactggtaccggacgattgagcgctatggcgtaacc
gtatggtacagcgcaccgacggccttccggatgctgatgggcgccggcgacgatgccgtg
aagcagttcaacctgggatcgctccgccacgtgctgagcgtaggcgagccgctcaatccg
gaagttgtccggtgggggctcaaggtctacaaccagcgtatccacgatacgtggtggatg
acggagaccggcggccagctcatctgcaactacccgtgcatggcgatccgtcccggctcg
atgggtaagccgctgccgggtatcgaggcggccatcatcgacgattcgggcaacgtgctc
ccgccgtaccgcatgggcaacctggcgatcaagacgccttggccgtccatgatgcgcaag
atctggaagaacccggcgaagtacgaagagtacttccggattcagggctggtacatttcg
ggcgactccgcttatatggacgaagacggctatttctggttccagggacggatcgatgac
gtcatcaacaccgcgggcgagcgcgtaggcccgttcgaggtcgagagcaagctcgtcgag
cacccggccgtagccgaagccggtgtcatcgggaagcccgatccgatgcgcggcgagatc
atcaaagcgttcatcgccctgcgcgaaggctacacgccgtccgacgagcttaaggccgac
atctcgcgcttcgtgaaggaaggcctgtccgcccacgcggccccgcgtgagatcgagttc
aaagacaagctgccgaagacccgcagcggcaaaatcatgcgccgcgtcctcaaagcctgg
gagctgaacctccctacaggcgacctgtccacgatcgaggattag

DBGET integrated database retrieval system