KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03964Help
Entry
KNP414_03964      CDS       T01550                                 

Gene name
rocF
Definition
protein RocF
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KNP414_03964 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KNP414_03964 (rocF)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KNP414_03964 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4114114..4115028
Genome map
AA seq 304 aa AA seqDB search
MSAVKDISVLCVPFDLGAGRKGVRLGPHAILQAGLERRLRGLGLQVEVLQPFPVPQAGIS
EPAVRTEEALLHLDEVAGLNELLAQAVWGILGRGRFPLVLGGDHSIAIGTLAGIAPHLKN
PGVIWFDAHSDLNTPETSPSGNIHGMSLAAALGLGHDRLVRIGGITPKIKPEHTVIIGAR
SLDPGEKERIRSLGIRCFTMHEIDRMGISRVMEEALHIAGAGTDGIHVSFDIDSMDPGEA
PGTGTPVRGGLSYREAHCALEMLSESGLVRSAEVVEVNPVLDTDNKTARLAAELMGSLLG
QRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtaaaggacatctctgtcctgtgtgtcccctttgatcttggagccggacgc
aagggcgtacgcctcgggccgcatgccatcctccaagccggactcgaacgccggctgcgc
gggctgggcctccaggtggaggtgctgcagccattccctgtaccgcaggccggcatatcc
gagcccgccgtccggacggaagaggcccttctccacctggatgaggtcgccggactgaac
gagctgctggcccaggccgtctggggcattctcgggcggggacggttcccgctcgtgctc
ggcggagaccacagcatcgccatcggcacgctcgccggcatcgcgccgcacctcaagaac
cccggtgtgatctggttcgacgcccattcggatctcaatacccccgagaccagtccgtcc
ggcaacatccacggcatgtcccttgcggccgctctcggccttgggcatgaccggctcgtg
cggatcggcgggattaccccgaagatcaaaccggagcacacggtcatcatcggtgccagg
tcgctcgatcccggggagaaggagagaatccggtcgctgggcatccgctgcttcacgatg
cacgagatcgaccgaatggggatctcccgcgtcatggaagaagccctgcacatcgcaggg
gccggaacggacggcatccacgtctccttcgacatcgacagcatggaccccggcgaagcc
cccggcaccggcacccccgtacgcggaggactcagctaccgcgaagcgcactgcgcgctc
gagatgctgtccgaatcgggcctggtccgctcggccgaggtcgtggaagtgaatccggtg
ctcgataccgacaataaaaccgcccggctggcggccgaactcatgggctcgctgctcggc
cagcgaatcttatag

DBGET integrated database retrieval system