KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03964Help
Entry
KNP414_03964      CDS       T01550                                 

Gene name
rocF
Definition
protein RocF
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pms01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pms00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4114114..4115028
Genome map
AA seq 304 aa AA seqDB search
MSAVKDISVLCVPFDLGAGRKGVRLGPHAILQAGLERRLRGLGLQVEVLQPFPVPQAGIS
EPAVRTEEALLHLDEVAGLNELLAQAVWGILGRGRFPLVLGGDHSIAIGTLAGIAPHLKN
PGVIWFDAHSDLNTPETSPSGNIHGMSLAAALGLGHDRLVRIGGITPKIKPEHTVIIGAR
SLDPGEKERIRSLGIRCFTMHEIDRMGISRVMEEALHIAGAGTDGIHVSFDIDSMDPGEA
PGTGTPVRGGLSYREAHCALEMLSESGLVRSAEVVEVNPVLDTDNKTARLAAELMGSLLG
QRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtaaaggacatctctgtcctgtgtgtcccctttgatcttggagccggacgc
aagggcgtacgcctcgggccgcatgccatcctccaagccggactcgaacgccggctgcgc
gggctgggcctccaggtggaggtgctgcagccattccctgtaccgcaggccggcatatcc
gagcccgccgtccggacggaagaggcccttctccacctggatgaggtcgccggactgaac
gagctgctggcccaggccgtctggggcattctcgggcggggacggttcccgctcgtgctc
ggcggagaccacagcatcgccatcggcacgctcgccggcatcgcgccgcacctcaagaac
cccggtgtgatctggttcgacgcccattcggatctcaatacccccgagaccagtccgtcc
ggcaacatccacggcatgtcccttgcggccgctctcggccttgggcatgaccggctcgtg
cggatcggcgggattaccccgaagatcaaaccggagcacacggtcatcatcggtgccagg
tcgctcgatcccggggagaaggagagaatccggtcgctgggcatccgctgcttcacgatg
cacgagatcgaccgaatggggatctcccgcgtcatggaagaagccctgcacatcgcaggg
gccggaacggacggcatccacgtctccttcgacatcgacagcatggaccccggcgaagcc
cccggcaccggcacccccgtacgcggaggactcagctaccgcgaagcgcactgcgcgctc
gagatgctgtccgaatcgggcctggtccgctcggccgaggtcgtggaagtgaatccggtg
ctcgataccgacaataaaaccgcccggctggcggccgaactcatgggctcgctgctcggc
cagcgaatcttatag

DBGET integrated database retrieval system