KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04037Help
Entry
KNP414_04037      CDS       T01550                                 

Gene name
pyrC
Definition
protein PyrC
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pms00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4181105..4182394)
Genome map
AA seq 429 aa AA seqDB search
MGIWIVNASVVAAGSEVTKKHILVDGGVVERIVDAEAGQPDTAGHTVVDAAGKLLTAGLI
DMHVHLREPGFEYKEDIASGTRSAAKGGFTTIACMPNTRPVIDTVETVKYVLDKAETEGI
VRVLPYGCITKNELGRELTDFDALKEAGVIGYTDDGVGVQSAQMMKDAMAKAASIGMPII
AHCEDNTLVEGAAVSEGAFARKHGLKGIPNESEAIHVGRDILLAEATGVHYHVCHVSTEQ
SVRLIRHAKQFGIKVTAEVCPHHLILSDEDIPDSMDANWKMNPPLRTPRDVQACIEGLVD
GTIDIVVTDHAPHSAEEKARGMQLAPFGITGFETAFPLLYTKFVTTGEWTLEFLVDKMTK
LPAQVFGLPWGTLEVGKTADLTLIDLETEKEVKPEEFLSKGKNTPFTGWKLRGWPSLTMV
GGQVVWSAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggggatttggatagtgaacgccagcgtggtggcagccggcagtgaggtaacgaagaag
cacattctggtggacggcggtgtcgtggagcgcatcgtggatgcggaagcgggccagccg
gacacggcaggacacacggtggtggatgcggcgggcaagctgctgacggcagggctcatc
gacatgcacgttcatctgcgcgagccggggtttgagtacaaggaggacatcgcctccggt
acgcgctcggcagccaaggggggcttcacgacgatcgcctgcatgccgaatacccggccg
gtgatcgatacggtggagacggtgaagtacgtgctggacaaggccgagacggaagggatc
gtccgcgtgctgccttatgggtgtatcacgaagaacgagctcgggcgcgaactgacggac
ttcgatgccctgaaggaagccggcgtcatcggctacacggatgacggcgtcggcgtgcag
agcgcgcagatgatgaaggatgcgatggcgaaggccgcttcgatcggcatgccgatcatc
gcccactgcgaagacaacacgctcgtcgaaggggcggcggtatccgagggcgcgttcgca
cgtaagcacggactgaagggcattccgaacgaatccgaagcgattcacgtaggccgcgac
attctgcttgcggaagccacgggagtccactaccacgtctgccatgtgagcaccgaacag
tcggtccgcctcatccgccatgcgaagcagttcggcatcaaggtcaccgctgaggtgtgc
cctcaccacctgatcctctcggacgaagacattccggacagcatggatgccaactggaaa
atgaacccgccgctgcgcaccccgcgcgacgtgcaggcgtgcatcgaaggcctggtggac
ggcacgatcgacatcgtggtcaccgaccacgcgccgcacagcgccgaagagaaggcccgc
ggcatgcagctcgcgccgttcggcatcaccggcttcgagacggccttcccgctcctgtac
acgaagttcgtgacgacaggggagtggacgctggagttcctcgtcgacaagatgacgaag
ctgccggcgcaggtgttcggtctgccgtgggggacgctggaggtcggcaagacggcggat
ctcacgctgatcgacctggagacggagaaggaagtgaaaccggaggagttcctctccaaa
gggaagaacacgccgttcaccggatggaagctgcgcggctggccgtccctgacgatggtc
ggcggacaggtggtctggtcggccgaataa

DBGET integrated database retrieval system