KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04062Help
Entry
KNP414_04062      CDS       T01550                                 

Gene name
murA2
Definition
protein MurA2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_04062 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KNP414_04062 (murA2)
Enzymes [BR:pms01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KNP414_04062 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4205367..4206635)
Genome map
AA seq 422 aa AA seqDB search
MEKLVIEGGKPLSGAIKIHGAKNAALPILAAGIMAEGTVVIENVPDLSDIHVMLGILQAL
GCQAEYLGDTVTVNTMGVHEFHIPEHLMSQMRSSIFLMGPLLARLGRVELYQPGGCAIGE
RKIDLHLRGLTALGAHIEESGSKIVCTAKELRGAEIVLDFPSVGATENIMMAAATARGST
TITGAAREPEIQDLQNFLNSMGAKIMGAGTDTITIEGVPVLTPGTYRIIPDRIVAGTLMI
AAAVTKGNITLEQVCPAHMTSAIHVLKRAGVQIAISGDIMNVCAPTRPKAVERIVTSPHP
AFPTDLQSQIMVLLSLADGVSVVKETVFEGRFKHVDELSRMGADIRVDLNAAMIRGVPRL
YGATVEATDLRAGAALVIAGLAAQGTTVIEQIHHIDRGYDRIESMLSALGASIHRVSPVP
SE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagttggttatcgaaggcgggaaacctctatcgggagccatcaagattcacgga
gccaaaaacgccgcactgcctatcctggcagccggcatcatggcggaaggcaccgtagtc
attgagaatgtgccggacttgtccgatattcacgtgatgctcgggattctgcaggccctc
ggctgtcaggcggaatacctgggggatacggtgaccgtgaacacgatgggggttcatgaa
ttccacattccggagcacttgatgagccagatgcggtcttcgatcttccttatgggcccg
ctgctcgcacggctcggccgggtggagctgtatcagcctggagggtgcgcgatcggagag
cgaaagatcgatctgcatctgcgcggcctgacggccctcggtgcgcatatcgaggagagc
ggcagcaagattgtttgtacggccaaggaactgcggggggcggagatcgtactcgacttc
ccgagcgttggagccaccgagaatatcatgatggccgccgccacggcccggggttccacc
acgattacgggagcggcgcgcgagcccgagattcaggacctccagaacttcctgaattcc
atgggcgccaagattatgggggcggggacggacacgatcaccatcgagggtgtgccggta
ctgaccccgggcacctaccggatcatcccggaccggattgtcgccggaaccctcatgatc
gccgcagccgtcacgaaggggaacattacgctggagcaggtgtgtccggcgcatatgacc
tcggcgattcacgtgctgaagcgcgcaggtgttcaaatcgcaatcagtggtgatataatg
aacgtatgcgctcccacccgccccaaagcggtggagcggatcgtgacatcgccgcacccg
gccttcccgaccgatctgcagtcgcagattatggtgctgctgagcctcgcagacggggta
agcgtagtgaaggaaacggtttttgaaggaagattcaagcacgtggatgaactctcccgc
atgggagccgacatccgggtggatctcaatgcggccatgatccggggcgttccccggctg
tacggggccacggtggaagccacggaccttcgtgcgggagcggctctggtgatcgccggc
cttgcagcgcaggggacgacggtgatcgaacagattcatcacatcgaccgtggttacgac
cggatcgagtctatgctgagtgcactcggcgcaagcattcacagggtatcaccggtacca
tcggagtaa

DBGET integrated database retrieval system