KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04321Help
Entry
KNP414_04321      CDS       T01550                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pms01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pms00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4536325..4537752)
Genome map
AA seq 475 aa AA seqDB search
MEINWLAEVEKRKDDLLKDLEGLLRIASVKDVTTSTPEYPMGEKIGEALDYVLALAQNEG
FTTKNLDGFAGFAEWGASEEYIGVLAHVDVVPAPGEWTTPPYEPTVREGKLYARGAIDDK
GPGMAAFYALKILKDLGLPLKRKIRMIYGTDEESGMGCVKHYLDVEPEPTYGFSPDDVFP
IVYAEKGQMNVKLTLSGSEEEQHGTILVNFSSGDRGNMVPGQAAAEMKTNQPEELMNRFK
TYCKEQGLHGEVSKSDETITLTLYGKTVHGMEPQNGVNAGLECLHFLNTLSFAGRDQSFI
TFADNCLYRDPFGEKLGIQYSEDVLGPLTVNAGIFKYNHADGGSIQLNIRVPLNNDYQHT
IEMITKKAETCHFTIAEAQQFPTHYIPADHPMIKTLQSAYQSITGDEPTLVTSGGATYAT
LMKNAVAYGALFPGKVDSSHQIDEFIEIDDLIKATAVYAKALYDLSHLYNQQKTG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaattggctggcagaagtggaaaaaagaaaagatgatcttttaaaggacttg
gaaggcttattgcgtattgcgagtgttaaggatgtaacaacgagtactcccgaatatcca
atgggggaaaagattggcgaagcattggattatgttttggcattagcccaaaatgagggg
tttacaactaaaaacttagacggctttgccgggtttgctgaatggggagcgtctgaagaa
tatattggggtacttgcccatgtcgacgtggttccagctcccggagagtggacaacgcca
ccttatgagccaactgttcgagaaggaaagctctatgcccgcggagccattgatgacaaa
ggaccgggaatggctgcattttatgcgttgaagatattgaaggaccttggccttccttta
aaaaggaaaatccgcatgatctatggcacagatgaggaaagtggtatgggctgtgtgaaa
cattatcttgacgtagagcccgagccaacttacggtttttctcctgatgatgtatttccg
atagtgtatgccgaaaaagggcaaatgaacgtgaagctgactctaagtggcagtgaagaa
gaacaacacggaactattttagttaacttttcctccggtgacaggggaaacatggtacct
ggacaagccgctgctgaaatgaaaacgaatcaacctgaggaacttatgaatcgttttaaa
acctattgtaaggaacaggggctgcacggtgaggtcagcaagtccgatgaaacgattact
ttaaccctttatggtaagaccgtgcatggtatggaaccgcaaaatggagtgaatgccgga
ctggagtgcctgcatttcttaaacacattaagctttgcgggtagggaccaatcattcatc
acatttgccgataactgcctatatagagatccttttggggaaaagctgggaatccaatac
agtgaagatgtgctcggacccttaacggtcaatgccggcattttcaaatacaatcatgca
gatggtggctccattcagttgaacattcgcgtccccttaaataatgattaccaacatacc
attgaaatgatcacgaaaaaagcggagacctgccattttacaatcgctgaggcgcagcaa
ttccctacacattatatccctgccgatcatccaatgattaaaacactgcagtcggcttat
caatcgattacaggggatgaacccacacttgtaacatcgggcggggcaacgtatgcgacg
ttaatgaaaaatgcggtggcttacggtgcgcttttccctggcaaggtagatagctctcac
caaattgatgaatttatagaaatcgatgatttaatcaaagcgacagccgtctacgccaaa
gcattatatgatttaagccacttatataaccaacaaaaaacaggatag

DBGET integrated database retrieval system