KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04703Help
Entry
KNP414_04703      CDS       T01550                                 

Gene name
fucI
Definition
protein FucI
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KNP414_04703 (fucI)
Enzymes [BR:pms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     KNP414_04703 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5100412..5102205)
Genome map
AA seq 597 aa AA seqDB search
MTKVHTANRLQGSMPKIAIRPVIDGRRGGIRESLEEVTMELARAVSGLLSARLRHANGLP
VECVIADTCIGGVAEAAAAEEKFAREGAGVSITVTPSWCYPTETMDTDPFRPKAVWGFNG
TERPGAVYLAAVLAAHNQAGLPAFGIYGRDVQDMGDTSIPDDVQEKLLRFAKAGLAAATM
RGKSYLSMGSVSMGIAGCIADEPFFRRYLGMRNEYVDMSEFIRRMEREIYDPEEFVRALE
WTRTHCREGEDVNPPALRRSRSQKDADWETVVKMALIARDLMVGNPALDRLGYGEEALGR
NAIAAGFQGQRAWTDHYPNGDFMEAVLTSSFDWNGIREPYMLATENDTLNGVTMLFGHLL
TDAAQIFADVRTYWSPDAVKRVTGYELQGSAAHGLIHLINSGPAALDGTGRMRKDGLPVM
KPFWEITEEEVQACLEAVQWCPAVDFFRGGGFSTDYTTSAGMPVTMARINLVHGLGPVLQ
LAEGVTVELPDEVHRKLDERSNPTWPTTWFAPNLTGTGAFRDVYTVMNHWGSNHAAVSCG
HIGADLITLASILRIPVAMHNVPSERLLRPSAWGAFGTEDTTGADFRACANFGPLYG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtacatacagccaaccgcctgcagggaagcatgccgaaaatcgcgatccgg
ccggtcatcgacggccggcggggaggcatccgcgaatcgctggaggaggtgacgatggag
ctggcccgcgccgtgtccggtctgctctccgcccggctccggcacgcgaacgggcttcct
gtggagtgcgtcatcgccgacacctgcatcgggggcgtcgcggaagccgccgcggcagag
gagaaatttgcccgcgaaggagcgggagtctccatcacggtgacgccttcatggtgttat
ccgaccgaaacgatggatacggatccgttccggccgaaggcggtctggggcttcaacggg
acggagcgccccggagccgtgtatctcgccgccgttctggccgcgcataaccaggccggg
ctgccggccttcggcatctacggccgcgacgtgcaggacatgggcgacacgtcgatcccg
gacgacgtgcaggagaagctgctgcgcttcgccaaggcggggcttgccgcggccaccatg
cgcggcaagtcgtatctgtccatgggctcggtgtcgatggggatcgccggctgcattgcc
gatgagccctttttccggcggtatctcggcatgcgcaacgaatacgtcgatatgagtgag
ttcatccggcggatggagcgggagatctacgacccggaggagttcgtgagagccctggag
tggactcgtacgcactgccgggaaggggaggatgtgaaccctcccgccctgcggcgcagc
cgcagccagaaggacgccgattgggagaccgtcgtgaagatggcgctcatcgcccgcgac
ctgatggtcggcaacccggcgcttgaccggctcggctacggcgaggaggcgcttggccgc
aatgcgattgccgccggcttccagggccagcgggcatggacggatcattatccgaacggg
gacttcatggaggcggtgctgacgagctccttcgactggaacggcatccgggagccctat
atgctggccacggagaacgacaccctgaacggcgtcacgatgctcttcggccatctgctg
acggatgccgcccagatcttcgccgatgtaaggacgtattggagcccggatgccgtgaag
cgcgtgacaggttatgaacttcagggcagcgccgcgcacggcctcatccacctcatcaat
tcgggcccggcggcgctggacggaacgggcaggatgcggaaggacggactcccggttatg
aagccgttctgggagattacggaggaggaggtgcaggcctgcctggaggccgtgcagtgg
tgccccgccgtcgacttcttccggggcggcggcttctccacggattacacaacgtcagcc
ggcatgccggtaaccatggcgcgcatcaacctggtgcacggccttggtcccgtactgcag
ctggccgagggcgtcacggtcgagctgccggatgaggtgcaccggaagctcgacgagcgg
agcaacccgacctggccgacgacctggttcgccccgaacctgacgggcacaggtgccttc
cgcgatgtgtatacggtcatgaaccactggggctcgaaccacgcggcggtcagctgcggg
catatcggagcggatctcatcacgctggcctccatcctccggattccggtggcgatgcac
aacgttccgtccgagcggctgctgcggcccagcgcctggggagccttcggcacggaggac
acaacgggcgccgacttccgggcctgcgcgaatttcggcccgttgtacgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system