KEGG   Paenibacillus mucilaginosus KNP414: KNP414_05797Help
Entry
KNP414_05797      CDS       T01550                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pms00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KNP414_05797
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    KNP414_05797
Enzymes [BR:pms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     KNP414_05797
Two-component system [BR:pms02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   KNP414_05797
Bacterial motility proteins [BR:pms02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    KNP414_05797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6397893..6399050)
Genome map
AA seq 385 aa AA seqDB search
MPPYDILVVDDSVFMRKIITDLISEDPAFRVVGAAKNGREGVEMVKKLKPHAVTLDIEMP
EMNGLEALKAIMKDHPVPVIMLSSLTQEGAAETIRALEWGAFDFVGKPSGSISLDLHKVK
ALLLEKLHTAVKAKVRPVTGISWSSRTASAAQAAPPASRTPAAAAPPVPPMRTETPAAKP
PERIRSAGAGVQTFDHLVAIGTSTGGPRALHQVLSDMPDHYPAPVLIVQHMPPNFTKSLA
QRLDSISKLTVVEAENGMVLERGTAYVAPGGYHMTVARNGTQSYKIHLSKDEPRGGHRPS
VDTMFESLLPLKELKRHIVIMTGMGADGAKGMQALKQAGAITTIAESEETCVVYGMPRAA
VELGCVMHVVPQQQIAGMLIQSVGR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgtatgacatattggttgtggacgattcggtattcatgcgcaagatcatcacc
gacctgatctccgaggacccggcgttccgggtcgtcggagccgccaagaacggcagggaa
ggcgtggagatggtcaaaaagctgaagccgcacgccgtcacactcgatatagagatgccg
gagatgaacgggctggaagcgctcaaggccattatgaaggaccatccggttcccgtgatt
atgctgagctccctgacccaggaaggggcggcggagacgatccgggccctggaatggggg
gctttcgacttcgtcggcaagccttcgggatccatctcgctggatctgcacaaagtgaag
gcgctgctgctcgagaagctgcatacggccgttaaagccaaggtgaggccggtaaccggc
atatcctggagctcgcgaacggcctctgcggcccaggccgcgccgcctgcatccagaacg
cctgccgccgccgcgcctccggtgccgcctatgcggacagagacgccggcggccaaaccg
ccggagcggatccgttccgccggagcgggcgtgcagaccttcgatcacctggtggcgatc
ggcacgtccaccggcgggccgcgcgcgctgcaccaggtgctctcggatatgccggatcac
tatccggctccggtgctgatcgtgcagcatatgcctccgaattttaccaagtcgctggcc
cagcgcctcgattcgatctcgaagctgacggtggtggaagcggagaacggcatggtgctc
gaacgggggaccgcttacgtggccccgggcggctaccatatgaccgtagcccgcaacggc
acccagtcttacaagatccacctctccaaagacgagccccgcggcggccaccgtccttcg
gtcgacacgatgttcgagtcgcttctgccgctcaaggagctgaagcgccatatcgtgatc
atgaccggtatgggggcggacggcgccaagggaatgcaggcgctgaagcaggccggcgca
atcacaacgatcgccgaatcggaggagacctgtgtggtctacggcatgccccgtgcggcc
gtggagctcggctgtgtgatgcatgtagtgccccaacagcagattgcgggcatgctgatc
caatccgtgggacgctga

DBGET integrated database retrieval system