KEGG   Paenibacillus mucilaginosus KNP414: KNP414_05831Help
Entry
KNP414_05831      CDS       T01550                                 

Gene name
sucC
Definition
(GenBank) SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00020  Citrate cycle (TCA cycle)
pms00640  Propanoate metabolism
pms00660  C5-Branched dibasic acid metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KNP414_05831 (sucC)
   00640 Propanoate metabolism
    KNP414_05831 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KNP414_05831 (sucC)
Enzymes [BR:pms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KNP414_05831 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEI44355
UniProt: F8F9M6
Position
complement(6430955..6432115)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLKQYGVAVPEGKVAFSVDEAVEAAKALGTPVVVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYASEILGKVLVTHQTGPEGKEVKRLLIEQGCDIKKEYYIGLVVDRGTGR
VVMMASEEGGTEIEEVAEHSPEKIFKEVIDPAIGLQAFQARKLAYSINIPAELVNKAVKF
MTALYTAFVEKDCSIAEINPLVVTGDGSVMALDAKLNFDSNALFRHKDILELRDLEEEDE
KEIEASKFDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATTEKVTE
AFKIILSDPKVKGIFINIFGGIMKCDVIANGVVEAAKQVGLDRPLVVRLEGTNVELGKKI
LAESGINIVAADSMADGAQKIVSLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggcaaagcagtgctcaagcagtatggggttgccgtaccg
gaaggtaaagtcgcattttcggtggacgaagccgttgaagcggcgaaggccctcggcact
cccgttgttgtggtgaaagcgcagattcatgccggcggccgcggtaaagcgggcggcgtg
aaagtagccaagaacctcgatgaagttcgtacatacgccagcgaaatccttggcaaagtc
ctcgtcacgcatcagacaggtccggaaggcaaagaagttaagcgtttgcttatcgaacaa
gggtgcgatatcaagaaggaatactacatcggtctcgtcgttgaccgcggcaccggacgt
gtggtcatgatggcttccgaagagggcggcacggagatcgaagaagtggccgagcattcc
cctgagaagattttcaaagaagtgatcgacccggcgatcggcctgcaggctttccaggcg
cgcaagctggcttacagcatcaacattcctgccgaactcgtgaacaaagcagtgaagttc
atgacggctctctatacggcattcgttgaaaaggactgctccatcgccgagatcaacccg
ctggttgtaacgggcgacggcagcgtcatggcactggacgcgaagctcaatttcgattcc
aacgccctgttccgccacaaggacatcctcgagctccgcgacctcgaagaggaagacgag
aaggagatcgaagcttccaagttcgacctgagctacatcgccctcgacggcaacatcggc
tgcatggttaacggtgcgggcctcgcgatggctacgatggacatcatcaagtactacggc
ggcgatcctgccaacttcctggacgtagggggcggcgctacaacggagaaggtaaccgaa
gcgttcaagatcatcctctccgatccgaaagtcaaaggcatcttcatcaacatcttcggc
ggcatcatgaagtgtgacgtgatcgctaacggcgtggtggaagcggctaagcaggtaggc
ctggaccgtccgctcgtcgtgcgtctcgaaggcacgaacgtagagctcggcaagaagatc
ctcgccgagtccggcatcaacatcgtggcagccgattccatggctgacggcgcgcagaag
atcgtttcgctcgtgaagtaa

DBGET integrated database retrieval system