KEGG   Paenibacillus mucilaginosus KNP414: KNP414_05913Help
Entry
KNP414_05913      CDS       T01550                                 

Gene name
gmk
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pms00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6511369..6512010)
Genome map
AA seq 213 aa AA seqDB search
MTSNYSDTPVDKGILIVLSGPSGVGKGTVCKALRECAPDIVYSVSATTRSPREGEVDGVN
YFFKTREQFQQLIEQDQMLEWAEYVGNYYGTPRKFVEDTLNSGKDIILEIEVQGALKVKQ
KFPEGVFLFLLPPSLTELESRIVGRGTEPEDVIRSRMSVAVDEIAMMEHYDYAIVNDQVD
SACSRIRSILTAEHCRKDRMIAKIQHWMAEVRK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtaattacagcgataccccggtggacaaagggattctgattgtgctgtcgggc
ccatcgggcgtaggcaagggaacggtttgcaaggcgcttcgggaatgtgctcccgatatc
gtttactccgtatcggcaaccacgcgcagcccgcgcgagggggaagtcgacggagtgaat
tatttcttcaagacccgggaacaattccagcagctcatcgagcaggaccagatgttggaa
tgggccgaatatgtgggtaattactacggtactccgcgcaaattcgtggaagacacgctg
aacagcggcaaggacattatcctcgagatcgaagtgcagggtgcgctgaaggtcaagcag
aagtttcccgaaggggtgttcctgttcctgctgccgccgtcgcttactgagctggagagc
cggattgtcggacggggcacggagcccgaggacgtcatccgcagccggatgtccgttgcc
gtagacgagattgcgatgatggagcactacgattacgccatcgtgaacgatcaagtcgat
tcggcctgttcacggatccggagtattctgacggccgagcactgccgcaaggaccggatg
attgccaagattcaacattggatggcggaggtgagaaaataa

DBGET integrated database retrieval system