KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06148Help
Entry
KNP414_06148      CDS       T01550                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KNP414_06148
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KNP414_06148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6768798..6770555)
Genome map
AA seq 585 aa AA seqDB search
MERGKKHMKPFRLWGAWLSTAVAVLGLMLPFGAAYSQAAAAVPYGQLKVQGADLLGESGQ
RVQLRGMSSHGIHWYGDLVNPGSLKWLKEDWNSNLFRVAMYTAEKGYITDPSVKEKVKEA
VQAAIDLGLYVIIDWHILTDGDPNTYKTQAKAFFQEMAALYGQYPNVIYELCNEPNGNVT
WAGQIKPYAQELTQAIRAIDPDNIIIVGTPNWSQDVNQAADSPLPYGNIMYAAHFYAGTH
GQWLRDKIDYARSKGAAVFVTEWGASDASGDGGPFLREAQEWIDFMNSRGISWANWSLAD
KEETSAALLPGANPSGGWPASQLSASGQFVRSKLRESLVSVPAAPAGLQAAPGSGQAALS
WNAVNGATGYIVNRAAVSGGPYTTVAELTGTSYTDTGLANGTTCYYVVSAKNAAGTGPAS
AQVSVQPAAGQGGGTPVPGSLVLQYRAADTNAGDNAIKPHFNIRNTGASPVDLSGVKLRY
YFTKDGTQPLSFTVDWAQVGSPNVKGTFGSASGAGADTYLEVSFTGGSIPAGGQTGEIQT
RIHKSDWSSFQESGDYSYDPGKTSYADWSKVTLYRDGTRVWGVEP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggagaggggaaaaaagcacatgaaaccattccgcttatggggggcatggctcagtacc
gcggttgcggtcctcggcctgatgctgccgttcggtgcagcatacagccaggcggctgcg
gccgttccttacggccagctgaaggtgcagggggccgacctgctgggcgagagcgggcag
cgcgtccaactgagggggatgagctcccacggcatccactggtacggggatctcgtgaac
ccgggcagcctcaagtggctcaaggaagactggaactccaacctgttccgggtggcgatg
tacacggcggagaaggggtatatcaccgacccttcggtgaaggagaaggtgaaggaggca
gtgcaggctgccattgacctcgggctgtatgtcatcatcgactggcacatcctgaccgac
ggggacccgaacacctacaagacgcaggccaaagcgttcttccaggagatggccgcgctg
tacgggcagtatccgaatgtcatctatgagctgtgcaacgagccgaacgggaacgtgacc
tgggcgggccagatcaagccttacgcgcaggagctcacccaggcgatccgggcgatcgac
ccggacaatatcatcatcgtcggcacgccgaactggagtcaggatgtgaaccaggcggcg
gacagcccgctgccgtacggcaacatcatgtatgcggcccatttctacgcgggtacgcac
ggccagtggctgcgcgacaagatcgactatgcgcggagcaagggagcggcggtattcgtc
accgagtggggggcgagcgacgcttcgggggacggcggaccgttcctccgtgaggcgcag
gagtggatcgacttcatgaacagccgaggcatctcctgggcgaactggtcgctggccgac
aaggaggagacttccgccgcgctgctgccgggagcgaatccctccggcgggtggccggct
tcgcagctcagcgcctccggccagttcgtgcggagcaagcttcgtgagagcctggtgagc
gtgccggccgctcctgcgggactgcaggccgcccccggcagcgggcaggccgccctgagc
tggaatgccgtcaacggagcgacgggctatatcgtgaaccgggcggcggtcagcggcggt
ccgtacaccacggtcgccgagttgacggggacctcgtacacggacacgggcctcgctaat
gggacgacctgctattatgtcgtcagcgcgaagaacgcggcgggcaccggtccggcctcg
gcccaggtgagcgtgcagccggcagccggccagggaggcggcacgccggtaccgggcagc
ctggtcctgcagtaccgcgccgccgacacgaacgcgggggataatgcgatcaagccgcat
tttaacatccgcaatacgggtgcttctcctgtggatctgagcggagtgaagctccgctac
tacttcacgaaggacgggacccagccgctgagcttcacggtggactgggcgcaggtcggc
agcccgaacgtcaaggggacgttcggcagcgcctcgggcgccggagcggacacatacctg
gaggtgagcttcacgggcggcagcatcccggccggcggccagacgggcgagattcagacc
cgcattcacaagagcgactggtcgagcttccaggagtctggagattactcgtacgatccg
gggaagacctcgtacgcggattggagcaaggtgacgctctaccgggacggcacaagggtc
tggggcgttgagccataa

DBGET integrated database retrieval system