KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06181Help
Entry
KNP414_06181      CDS       T01550                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KNP414_06181
Enzymes [BR:pms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KNP414_06181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6801211..6802497)
Genome map
AA seq 428 aa AA seqDB search
MKFGLLPPADQIVLFMERIYGYGMTTTSGGNLSIRDDNGDIWITPAGVDKGALTRQDIVC
VKPDGQVVGAHRPSSEFPFHQRIYRDRPDLRAVVHAHPPALVAFSIVRRIPETRLLPDEH
EICGEVGMAAYAVPGSAELGERISEVFARGIDTVMLENHGVVAGGGDLFEAFQRFETLEF
CARLEIEASRIGTPVRLAADDIAKARACRELPLEPFTPAGYPTREREAREMMCRLIRRSY
DQRLFTSTQGTYSERIGGDAFLITPHGMDRKYLEPQDLVRIEGGRAEAGKKPSRSHLLHR
HIYEAHPHVNSVLIAHPPSIMAFAVTDADFDSRTIPESYLLLRRMPKLAFHAVYDDPETA
AAVFTKDTPIAIVRNNCVIVTGDSLLSAFDRLEVAEYSARSMIAAQSLGAIVHMDEERIG
ELEKAFGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggacttcttcctcctgcggaccagatcgtcctcttcatggagcgcatctac
gggtacgggatgacaacgacctccggcggcaatctctccatccgggacgacaacggagac
atctggatcactccggcgggcgtggacaaaggcgcgctgacccgccaggatatcgtctgc
gtgaagccggacggacaggtcgtcggcgcccacaggccgtccagcgaattcccgttccac
cagcgcatctaccgggaccggccggacctgcgggccgtggtgcatgcgcacccgccggcg
ctcgtggccttcagcatcgtgcgccgcatcccggaaacacggctgctcccggatgagcac
gagatctgcggagaggtgggcatggcggcttacgcggtaccgggcagcgccgagctcggc
gagcggatctcggaagtgttcgcccgggggatcgacacggtgatgctggagaatcacggc
gtcgtggcgggcggcggcgatctgttcgaagcgttccagcggttcgagacgctggagttc
tgcgcccggctggagatcgaagcgagccgcatcgggacgccggtacggctggccgcagat
gacatcgccaaggcgcgggcctgccgggagctcccgctggagccgttcaccccggccgga
tacccgacgcgggagcgggaggcgagggagatgatgtgccggctcatccggcgctcctat
gaccagcggctgttcaccagcacgcagggaacgtactcggagcggatcggcggggatgct
tttctgatcacgccccatgggatggaccgcaagtacctcgagccccaggacctcgtgcgg
atcgaaggcgggagggcggaggccggcaaaaagccaagccgctcgcacctgctccaccgc
catatttatgaggcgcacccgcatgtgaattccgtgctgatcgcccatccgccgagcatt
atggcttttgccgtcacggatgcggacttcgattcccggaccatccccgagagctatctg
ctgctccgccggatgccgaagcttgcgttccacgccgtgtatgacgatccggagacggct
gcggccgtcttcaccaaggatacgccgatcgccatcgtgcgcaataactgtgtcattgta
acgggagacagcctgctgagcgcgttcgaccggctggaggtggcggaatacagcgccagg
tcgatgatcgcggcgcagagcctgggagctatagtgcatatggacgaagaacggatcggg
gagcttgagaaggcttttggattgtaa

DBGET integrated database retrieval system