KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06234Help
Entry
KNP414_06234      CDS       T01550                                 

Gene name
rocF2
Definition
protein RocF2
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KNP414_06234 (rocF2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KNP414_06234 (rocF2)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KNP414_06234 (rocF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6861406..6862323)
Genome map
AA seq 305 aa AA seqDB search
MLMKLATNQRDISLIGVPLQLGADRAGVELGPHALRTSNIQQRLEYLGHRVHDTGDIHVN
RLDPCAPGEKLKYLAEIARVNAELAQRVAAEMGRGHFPLVIGGDHSVAIGTIKGVLQHVN
RLGVIWFDAHPDVNTEETTGSGNIHGMSLAVMLGYGHKSLISIGGEQAKINPRNVVIIGA
RSIDPGERIFLREQGIRVFTMHEIDKYGMRAVMDEAMERVTDGTDGVHLSLDLDGMDPQE
APGVGTPVSGGITYRESHYAMETLYESGALVSAEIVEVNPMLDIGNKTARAAVELAGSVF
GERIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaagcttgccacaaaccaacgggacatttcactgatcggcgtgccgcttcag
ctcggggcggaccgggcgggtgtcgagcttggcccccatgccctgcgaacctcgaacatt
cagcagcggctggagtacctcggccaccgcgtgcatgatacaggcgatatccacgtgaac
cggctcgatccctgtgcgcccggcgagaagctgaagtatctggccgagatcgcgcgggtg
aatgcggagctggcgcagcgggtggcggcggagatgggccgcgggcacttcccgcttgtc
atcggaggcgaccacagcgtggcgatcggcacgatcaaaggcgtgctgcagcatgtgaac
cggctgggggttatctggttcgacgcccatccggatgtgaacacggaggagacgacgggc
tccgggaacattcacggcatgtccctggcggtcatgctcgggtacgggcacaagagcctg
atctcgatcggcggcgaacaggcgaagatcaacccgcgcaacgtggtcatcattggcgcg
agatcgatcgatccgggcgagcgcatcttcctccgcgagcagggcatccgcgtcttcacg
atgcacgagatcgacaagtacggcatgagggccgtcatggacgaggcgatggagcgggtg
acggacgggacggacggcgttcatctcagcctggatctggacggcatggatccgcaggag
gcgccgggcgtcggcacgccggtcagcggcggcatcacctaccgggagagccactatgcg
atggagacgctgtatgagagcggggcgctcgtctccgcggagatcgtcgaggtgaacccg
atgctcgacatcggcaacaagacggcgcgggcggcggtggagcttgccggatccgtgttc
ggggaacgcatattgtaa

DBGET integrated database retrieval system