KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06466Help
Entry
KNP414_06466      CDS       T01550                                 

Gene name
hemB
Definition
HemB protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pms00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7132661..7133656)
Genome map
AA seq 331 aa AA seqDB search
MAFPLIRNRRLRTSAAMRRLVRENDVTLNDLIYPIFVTHGENIKEEIPSMPGVYHFSLDR
LQEEIAEVSALGLPAVLLFGVPHEKDAHGSSAYDPNGIVQQATRLIKTWDSELLVIADTC
LCQFTDHGHCGVVHYDEAKQRAEVVNDASLELLARTAVSQAEAGADIIAPSNMMDGFVHA
IRQGLDEAGYEHVPILSYSVKYASSFYGPFRDAAHSTPQFGDRKTYQMDPANGREALREA
DADVAEGADMLMVKPALAYMDVIRMLRDRYDLPICAYNVSAEYSMVKAAAAQGWIDERSI
VLETMVGFKRAGADMIITYFAKDIARWIARS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccattgatccgaaaccgccgtctgcgcacctcggccgccatgcgccggctg
gtgcgggagaacgacgttaccctaaatgatctgatctacccgatctttgttacgcatggg
gagaacatcaaggaagagattccatcgatgcccggcgtgtaccacttctcgctggaccga
ctgcaggaagagatcgcggaggtatccgctctcggactgccggctgttctgctcttcggc
gtaccgcacgagaaggatgcccacggcagctcggcctacgacccgaacggcatcgtgcag
caggcaacccgtctgatcaagacctgggattcggagctgctcgtgatcgccgatacctgc
ctgtgccaattcacggatcacggccactgcggcgtggtgcactacgacgaggcgaagcag
cgggccgaagtcgtcaatgacgcatcgctcgaactgctggcccgtaccgcggtctcccag
gctgaggcgggggccgatatcatcgcgccttcgaatatgatggacgggttcgttcatgcc
atccgccaggggctcgacgaagccggctatgagcatgtgccgattctgtcctactccgtc
aagtatgcttcctcgttctacggtccattccgggatgcggcccattcgacgcctcaattc
ggcgaccgcaagacctatcagatggatccggccaacggacgggaagcgctgcgcgaagcg
gatgcggatgtggcggaaggagcggatatgctcatggtcaagccggctctggcctacatg
gacgttatccgtatgctgcgcgaccgctatgatctgccgatctgcgcttacaatgtcagc
gcggagtactcgatggtgaaggccgccgccgcccagggctggatcgacgaacgctccatc
gtgctcgaaacgatggtgggcttcaagcgtgccggcgccgacatgatcatcacgtatttc
gccaaagacattgcccgctggatcgcccgttcctga

DBGET integrated database retrieval system