KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06467Help
Entry
KNP414_06467      CDS       T01550                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pms00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7133716..7135257)
Genome map
AA seq 513 aa AA seqDB search
MGEIRLKKGVVYLVGAGPGDPKLITLRGLEAIQRADVVVYDRLASPRLLKHMKPGAEKIF
VGKLPDKHMLKQEEINQLLVDLALQGKTVTRLKGGDPSVFGRVGEEAELLAENEILFEIV
PGITSSIAVPAYAGIPVTHRDFTSSFSIVTGHEYKNKTYNTVNWPNLAQASGTLIFLMGV
ANLEHICTQLMEGGKSPDTPVALIRWGTWMEQETLTGTLTDIVEKVRAAGFQSPAVTIVG
EVVRLREKLAWFEKKPLFGRRILVTRARSQSSELSAQIDELGGEAVEFPVIRTQPSSKPE
AQAARDEAMRSLGGFDWIFFTSVNGVESFFQRLRELKVDIRSMGGARIAAVGPKTAAALE
DRGLVVQTIPSEFQGAALLEALDGELKPGQQVLLPTADIAREELPEGLRARGLHVTKIDI
YETVLETEGGAEVLELLRQKAIHIVTFTSSSTVTNLIRALQEAGEAQPLELLRGCRIACI
GPVTAETAVEAGLQVDHIAKEATVASLVASLYE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggggagattcggttgaaaaagggagtcgtttatttggtgggcgccgggcccggggat
ccgaagctgattacgcttcgggggctggaggcgattcagcgggcggatgtcgtggtgtat
gaccgattggcaagccctcggcttctcaagcacatgaagccgggagccgagaagatcttc
gtaggcaagctgccggacaagcatatgctgaagcaggaagagatcaaccagctgctggtg
gacctcgcgctgcagggcaagaccgttacccgcctcaagggcggggaccccagcgtcttc
gggcgggtaggggaagaagcggagctcctggccgagaatgaaatcttgttcgagatcgtg
ccgggcatcacgtcttcgatcgccgtgccggcctatgccggtattccggtgacgcacagg
gactttacgtcttccttctcgattgtgacgggacacgaatacaagaacaagacctacaat
acggtcaactggccgaacctggcccaagcctccggcacactgatcttcctgatgggtgta
gccaacctggagcatatctgtacgcagcttatggagggcggcaagtcgccggatacgccg
gtggccctcatccgctggggaacctggatggagcaggagaccttgaccggcacgctgacg
gacatcgtggagaaagtccgggcagccggcttccaatccccggccgtcacgattgtcggc
gaggtggtccggctgcgcgagaagctggcctggtttgagaagaagccgctgttcggccgc
cggatcctcgtgacacgggcacgcagccagagcagcgagctgtctgcgcagatcgatgag
ctcggcggtgaggccgtcgagttcccggtgatccgtacgcagccttcgagcaaaccggaa
gcgcaggcggcacgggatgaagcgatgcgatcgcttggcggattcgactggatctttttc
acgagcgtcaacggagtggaatcgttcttccagcggcttcgcgagctgaaggtcgatatc
cgatccatgggcggcgcacggatcgcagcggtcggtccgaagacggccgccgctttggaa
gaccgcggactggttgttcagaccattccgtccgaattccagggcgccgcgctgcttgaa
gcgctggacggcgagctgaagccggggcagcaggtgctgctgccgacggcggatatcgcc
cgggaggaactgccggaaggcctgcgcgccaggggactgcacgtgacgaagatcgacatc
tatgagacggtgctggagaccgaaggcggcgcggaagtgctggagctgctgcggcagaag
gcgattcatatcgtcacctttacgagctcctcgaccgtaacgaacctgatccgtgcactg
caggaagcaggcgaagcgcagccgctggagctgctgcggggctgccggattgcctgcatc
ggcccggtgaccgccgagacggccgtcgaagccgggctccaggtggaccacatcgccaag
gaggctaccgtggcttcgctggtagcttcattatacgagtag

DBGET integrated database retrieval system