KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06653Help
Entry
KNP414_06653      CDS       T01550                                 

Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pms00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pms00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7327590..7329221)
Genome map
AA seq 543 aa AA seqDB search
MERSKLSLKQKIGQLLMCGFPGTEPTPEMEELIRDGGIGGIIYFRRNLAEPAQAAALSAK
LQGFAAEGSGVPLLIAVDQEGGMVTRIEQGVSVMPGAMALGATGDADAAYEAAKVTAAEL
LAMGINMNFAPVLDVNNNPLNPVIGVRSYGGDPELVARLGTAAVRGYQETGVAATVKHFP
GHGDTSQDSHHELPTVPHDRGRLDRLELVPFREAVRQGVDAVMTAHLLFPAVEPEPLPAT
LSPRVLTGLLREELGYGGVIVTDCLEMNAIAGHYGVAEGAVLAVEAGADLVLVSHRIELQ
RAALDALTAAVESGRLSEERIDRSVDRLGGGRLSEERIDRSVDRLLALKARRAVQAAEGT
APLIGRTLATPASQALAERIGEASVTLVAGELQPLERGRRVLVVWPEVRVGSEVDEVLGR
KESLGHWLAQMGFVVREERIGVRPTEEERQRVLRLAREGGQAVAVSYNAAFEPEQAALIR
ELAELPGLRLTAASVRIPSDLAVLGRVRVYLACYENTPFAMKALARVLGGELAPAGVLPA
PIL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagtaaactgagtctcaagcaaaagatcgggcagctgctcatgtgcggattc
ccggggacggaaccgacgccggagatggaggagctgatccgggacggcgggatcggcggc
attatctattttcggcgcaacctggcggagccggcccaagcggccgccttgtcggcgaag
ctgcagggcttcgcggccgaaggcagcggggtgccgctgctcattgctgtcgaccaggag
ggcgggatggtcacccgcatcgaacagggcgtaagcgtcatgccgggggcgatggcgctc
ggggcgaccggcgacgcggacgccgcgtacgaagcggccaaagtaacggctgccgagctg
ctggcgatgggcatcaacatgaacttcgccccggtgctcgacgtgaacaacaacccgctc
aacccggtgatcggcgtccgctcctacggcggggaccccgagctcgtggcgcggctgggt
accgcggccgtgcggggataccaggagacgggcgtcgccgctacggtcaagcacttcccc
ggccacggcgacacctcgcaggattcacatcacgagctgcctacggtgccgcatgaccgc
gggcggctcgaccggctggagctggtgccgttccgcgaagccgtccggcagggcgtggac
gccgtgatgacggcccacctgctcttcccggcggtggagccggaaccgctgccggctacg
ctgtcgccgcgcgtgctgaccgggctcctgcgcgaggagctcggctacgggggcgtcatc
gtcaccgactgcctcgagatgaacgccatcgccgggcattacggcgtggcggagggggct
gtgctcgccgtggaggccggcgcggaccttgtgctcgtctcgcaccgcatcgagctgcag
cgggcggcgctggacgcgctgaccgccgccgtggagagcggccgcctcagcgaagagcgc
atcgaccgctcggtcgaccggctgggggggggccgcctcagcgaagagcgcatcgaccgc
tcggtcgaccggctgctcgcgctgaaggcgcggcgggcggtgcaggcggccgaagggacg
gcgccgctgatcggccgcacgctggccaccccggcgtcgcaggccctcgccgagcggatc
ggcgaagccagcgtgacgctcgtggccggcgagctgcagccgctggagcgcggccggcgc
gtgcttgtcgtctggccggaggtgcgggtcggctccgaggtcgacgaagtgctcggccgc
aaggagtcgctcggccactggctcgcccagatgggcttcgtcgtgcgcgaggagcggatc
ggcgtccggccgaccgaagaggagcggcagcgcgtgctgaggctggcccgcgagggcggg
caggccgtagccgtgagctacaacgcggcgttcgagccggagcaggcggcgctgatccgc
gagctggcggagctgccgggcctgcggcttaccgcggcgtccgtgcgcatcccctcggac
ctggcggtcctgggccgtgtgcgggtgtatctcgcctgctatgagaacaccccgttcgcg
atgaaggcgctcgcgcgggtactgggaggtgaacttgcgccggccggcgtgctgccggct
ccgattttgtag

DBGET integrated database retrieval system