KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06741Help
Entry
KNP414_06741      CDS       T01550                                 

Gene name
gtaB4
Definition
protein GtaB4
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KNP414_06741 (gtaB4)
   00052 Galactose metabolism
    KNP414_06741 (gtaB4)
   00500 Starch and sucrose metabolism
    KNP414_06741 (gtaB4)
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_06741 (gtaB4)
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KNP414_06741 (gtaB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7426522..7427412)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIIDKPTIQYIVEEAVESGIEDIIIVTGKG
KRAIEDHFDHVHELEHNLNEKGKLELLEEVRRSSKVELHFIRQKEPKGLGHAVWTARKFI
GNEPFAVLLGDDIVSAEKPCLRQLIEQYEQTGSSVIGVQKVSDEETNRYGIIDPGQNQDR
LYEVRKFVEKPALGTAPSNLAIMGRYILTPEIFDILSLQELGAGGEIQLTDAIQKLNELQ
RVYAYNFEGTRHDVGEKLGFILTTLQFAMKSKELRQPVLNAIKETLANHKLIDVIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcaattattcccgcagcaggacttggaacaaggtttttgccc
gctacgaaggcgatgcccaaagagatgcttcccatcatagacaagcctaccatccagtat
attgtggaagaagccgtagagtccggaattgaagatatcattatcgtgacaggcaaaggc
aaacgggccattgaggatcatttcgaccatgttcacgagcttgagcataatctgaacgaa
aaaggcaagctggagcttctcgaggaagtacgccgttcttcgaaggtggagctgcacttc
atccgtcagaaagaaccgaagggtcttggacatgccgtatggaccgcacgcaagttcatc
gggaacgagccgttcgccgtacttctcggagacgatatcgtctcggccgagaagccttgc
ctgagacagctgatcgaacaatatgagcaaaccggctcctcggtgatcggcgtacagaaa
gtatccgatgaggagaccaaccgttacggcatcatcgatccgggtcagaaccaggatcgt
ctctacgaagtgcgtaaattcgtggaaaagccggctctgggcacagcgccttccaacctc
gcgatcatgggccgctacatcctgacgccggaaattttcgacattctgtccctgcaggag
ctgggtgccggtggagagattcagctgaccgatgctatccagaagctcaacgagctgcag
cgggtgtacgcctacaatttcgaaggcacacgccatgatgtgggcgagaagctgggcttt
atcctgacgacgctgcaattcgcgatgaagtcgaaggagcttcgccagccggtcttgaac
gcgatcaaggaaaccttggccaaccacaagctgattgatgtgattggctaa

DBGET integrated database retrieval system