KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06881Help
Entry
KNP414_06881      CDS       T01550                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KNP414_06881
Enzymes [BR:pms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KNP414_06881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7567640..7568464)
Genome map
AA seq 274 aa AA seqDB search
MRRLEGKRIALTGPRKAAELSIMVEKLGGIPVVRPAQGSVEMQREKVEEEIRKLVREGTD
WIVLTTSQGTEMLLEVAESIGLREEFLETLRQTPLAVRGYKTVKYLKTLDIEPEVKADDG
TTVGILRALQERSLDLQGRKVALQLYGDHAPRLVEWLATQGARHYGILPYRHVPPDLTVV
DTLLGEILGGAIDAVTFTSTPQVRFLMAYAREQGLAEKVLDAFRERVVGVAVGKVTAEAL
RDEGIVRVVAPEEERMGSMIVSLAKYYEDSEKTG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagattggaaggcaaacgcatcgcattgacggggccgcggaaggcggcggagctc
agtattatggtcgagaaactcggagggattcccgtggtccgtccggcccagggttcggtg
gagatgcagcgcgagaaggtggaggaagagatccgcaagctggtccgggagggcacggac
tggatcgtgctgacgacatcccaggggacggagatgctgctggaggtggcggaaagcatc
ggtctgcgggaagagttcctggagacgctccggcaaactccgctcgccgtacggggctac
aagacggtgaaatacctcaaaaccctggatatcgagccggaagtgaaagcagacgatggg
acgacggtcggtattctccgggcgcttcaggagcgttcgctggacctgcagggccgcaaa
gtggccctgcagctgtacggggaccatgcgccgcggctggtggaatggctggctacgcag
ggggcccgccattacgggattctgccttaccggcatgtgccgccggacctgacggtcgtc
gatacgctgctcggcgagattctgggcggggcgatcgatgcggtgacgttcacctccacc
ccgcaggtacgcttcctgatggcctatgcacgggagcaggggcttgcggagaaggtgctg
gacgccttccgcgagagagtcgtgggtgtcgccgtgggcaaggtaacggccgaagcgctg
cgtgacgaaggcattgtgcgcgtggtggcgccggaggaagagcggatgggcagcatgatc
gtctcactggccaagtactatgaggactccgagaaaaccggataa

DBGET integrated database retrieval system