KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07184Help
Entry
KNP414_07184      CDS       T01550                                 

Definition
pectate lyase P358
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KNP414_07184
   00500 Starch and sucrose metabolism
    KNP414_07184
Enzymes [BR:pms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KNP414_07184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7882988..7884163)
Genome map
AA seq 391 aa AA seqDB search
MKSKKSIPLALGAFLLVTAAAPWGALPDAASAASAASAGTEGAVFSASTMKEQEQMTKQA
IVDSSYQGTEGAVVDGVKQYRSVQKAILDVPADQASPYVIYLKAGVYKEVLNVDKPYVTL
VGENAKRTVITYDNASGTPKPDGSGTYGTTGSATVTVKGENFTAVSVTFENSFDEANSPY
QNKQAVAIKTQADRAIFKDCRFIGNQDTLYPNLGRQYFVDSYIEGDVDFIFGAATAVFEN
SRIHSLDRGSDTNNGYITAASTLNSNPYGYLFINCRLTSDPGMEGTVSLGRPWQPGGNTN
AIASVVFKHTHMGSHITSTGWVDMGASKAENARFFEYDSRGPGALESLTRPVLTKEQADL
HTPEAYFGDWDPKKVLEGLSPSFANPSLGHH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgaaaaaatccataccgttggccctgggggcattcctgctggtaaccgccgcg
gcgccttggggagccctgccggatgcagcctccgcagcctccgcagcctccgcaggaacg
gaaggagccgtattctcagcctcaacgatgaaggagcaggagcaaatgaccaagcaggcg
atcgtcgattcttcttaccaaggaaccgaaggggctgtcgtcgacggcgtcaagcagtac
cgttccgttcagaaagccatcttggatgtgccggcggaccaggcgtcgccttatgtcatc
tatctgaaggcaggggtctataaggaagtactcaacgtggacaagccgtatgttactctc
gtaggcgagaacgcgaagcgtacggtgattacctatgataatgccagcggcacaccgaag
ccggacggcagcggcacgtacggaaccacgggcagcgccacggtgacggtcaagggagag
aattttacggcggtcagcgtaacgttcgagaactcattcgacgaggcgaattcgccgtac
cagaacaagcaggccgtagcgatcaagacgcaggcggaccgcgcgatcttcaaggactgc
cgctttattggcaaccaggacacgctctacccgaacctcggccgccagtatttcgtggac
tcttatattgaaggggacgtcgacttcattttcggcgccgccacggcggtcttcgagaat
tcccgcatccactctctggaccgcggttccgataccaataacggctatattacggcagcc
agcacactgaactccaatccgtacggctacctgttcatcaactgccggctgacaagcgat
ccgggtatggagggcacggtttctctgggacgtccatggcagccaggcggcaatacgaat
gccatagcgagcgtcgtgttcaagcacacccacatgggcagccacatcacgtcgacgggc
tgggtggatatgggggcctccaaggcggagaacgcgcgcttcttcgaatatgacagcaga
ggaccgggggcgctggagagcctaacgcgtccggtgctcaccaaagagcaggcggatctt
cacacgccggaggcttacttcggtgactgggatccgaagaaagtgctggaggggctcagt
ccatcctttgccaatccgtccctcggacatcattaa

DBGET integrated database retrieval system