KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07188Help
Entry
KNP414_07188      CDS       T01550                                 

Gene name
bsaA2
Definition
protein BsaA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KNP414_07188 (bsaA2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KNP414_07188 (bsaA2)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KNP414_07188 (bsaA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7885962..7886453)
Genome map
AA seq 163 aa AA seqDB search
MSIYDFEVTTIRGEKTTLAPYQGQVLLIVNTATKCGFAPQFKGLQKLHDTYRDKGFAVLG
FPSSQFLDQELHDNADIAQSCELNHGVSFPLYAKIDVNGSGAHPLFQYLSSEARGLLGSK
AIKWNFTKFLVDRNGRVLKRFAPTDTPEMIESRIAELLDPAAV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctatgatttcgaggtcaccacgatccgcggagaaaagacgaccctggccccc
taccaggggcaggtgctgctcatcgtcaatacggcaaccaagtgcggatttgccccgcag
ttcaaggggctgcagaagctgcacgatacgtaccgcgacaaggggtttgccgtactgggc
tttccgagcagccagttccttgaccaggagctgcacgataacgcggacattgcgcagtcc
tgtgagctgaaccacggcgtgtcgttcccgctctatgcgaagatcgatgtgaacggcagc
ggtgcccatcccttgttccaatatctgagcagcgaggcccgcggtctgctcggctccaag
gcgatcaagtggaacttcaccaagttccttgttgaccggaatggccgtgtcctgaaacgt
tttgccccaaccgataccccggagatgatcgagagccggatcgcggagctgcttgatccc
gcggcggtgtga

DBGET integrated database retrieval system