KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07188Help
Entry
KNP414_07188      CDS       T01550                                 

Gene name
bsaA2
Definition
protein BsaA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pms00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pms00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7885962..7886453)
Genome map
AA seq 163 aa AA seqDB search
MSIYDFEVTTIRGEKTTLAPYQGQVLLIVNTATKCGFAPQFKGLQKLHDTYRDKGFAVLG
FPSSQFLDQELHDNADIAQSCELNHGVSFPLYAKIDVNGSGAHPLFQYLSSEARGLLGSK
AIKWNFTKFLVDRNGRVLKRFAPTDTPEMIESRIAELLDPAAV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctatgatttcgaggtcaccacgatccgcggagaaaagacgaccctggccccc
taccaggggcaggtgctgctcatcgtcaatacggcaaccaagtgcggatttgccccgcag
ttcaaggggctgcagaagctgcacgatacgtaccgcgacaaggggtttgccgtactgggc
tttccgagcagccagttccttgaccaggagctgcacgataacgcggacattgcgcagtcc
tgtgagctgaaccacggcgtgtcgttcccgctctatgcgaagatcgatgtgaacggcagc
ggtgcccatcccttgttccaatatctgagcagcgaggcccgcggtctgctcggctccaag
gcgatcaagtggaacttcaccaagttccttgttgaccggaatggccgtgtcctgaaacgt
tttgccccaaccgataccccggagatgatcgagagccggatcgcggagctgcttgatccc
gcggcggtgtga

DBGET integrated database retrieval system