KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07564Help
Entry
KNP414_07564      CDS       T01550                                 

Definition
protein FolK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KNP414_07564
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     KNP414_07564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8262618..8263151)
Genome map
AA seq 177 aa AA seqDB search
MMNEEKADIHSQEDLAVAYIGLGSNLGDREQYLKEALRMLEEHPEIRILGLSSFYETDPV
GYVDQDPFLNMVAAVGTTLSPEDLFAQMLGAEQHLGRKREVRWGPRTIDLDLLLYGSRTQ
EDPRLILPHPRMMERAFVLIPLIEVMKAQNPQQAGALEDHLRRLSGKEGVTLWKRMQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgaagagaaggcggatatacattcgcaagaagatctggcggtggcttatatc
ggcctcggctccaacctgggcgaccgggagcagtacctgaaggaggcgctccgcatgctg
gaagagcatccggagatccgcatcctcggcttgtcctccttctatgagacggatccggtc
ggctatgtcgatcaggacccgttcctgaacatggtggcggcagtcggaacgacgctgtcg
ccggaggatttgtttgcgcagatgctgggtgccgagcagcacctggggcgcaagcgggag
gtgcgatgggggccaagaaccatcgatctcgatctgttgctctacggaagccgcactcaa
gaggatccccgtctgattctgccgcatccccgcatgatggaacgtgccttcgtgctcatt
ccgctcatcgaggtgatgaaggctcagaatccgcagcaggcaggggccctcgaagatcat
cttcggcggctttcaggaaaggaaggcgttacgttatggaaaagaatgcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system