KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07566Help
Entry
KNP414_07566      CDS       T01550                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pms00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8263556..8264407)
Genome map
AA seq 283 aa AA seqDB search
METSERGRSSDTTSVLEREFPGRDKRTLIMGILNVTPDSFSDGGRYIDPASAVERAKQML
EEGADILDIGGESTRPGFAPVPLEEELRRVLPAIRAIREAGIKVPISIDTYKAETARQAL
EAGATWLNDIWGLQRDEAMARVAAEYAAPIVLMHNRTEPVYANFIQDVVDDLQRTVERAR
AAGIAEEQIILDPGIGFAKTYEQNLQLMNHLERIVGLGFPVLLGTSRKRMIHQTLQLPPH
DVVEGTAATVALGVAQGCRIMRVHDVRAMRRVADMTDAIIRQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagacttcagagcgtggacgcagcagcgatacgacatccgtcttggagcgggaattt
ccgggcagggataagcgtaccctgattatgggaatcctgaatgtcaccccggattcgttc
tcggacgggggacggtatatcgacccggcgtctgccgtggaacgggcgaagcagatgctg
gaagaaggagccgatatcctggatatcggcggcgagtcgacaagacccggcttcgcaccg
gttccgctggaggaagagctgcggcgtgtgctgcctgccattcgtgcaatccgggaggcg
ggcattaaggttcctatctccattgatacatacaaggcggagacggcccggcaggctttg
gaggccggggccacttggcttaatgatatttggggcctccaaagggatgaggctatggcc
cgggtagccgccgaatatgcggctcctatcgtgctgatgcataatcggaccgagccggtg
tatgctaactttatccaggacgtagtggacgatctgcagcggaccgtggaacgggcgagg
gccgcagggattgcggaggagcagatcattctcgatccggggatcggttttgccaagacg
tacgagcagaaccttcagctgatgaaccacctggagcgtattgtcgggctcggctttccg
gtgcttctcggcacgtcgcgcaagcggatgatccaccagacgctgcagcttccaccgcac
gacgtagtggaaggaaccgctgctacggtcgcccttggggttgcccaaggctgccggatt
atgcgggtgcatgatgtacgtgccatgcgccgggtggcggatatgaccgatgcaatcatc
aggcagagataa

DBGET integrated database retrieval system