KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07569Help
Entry
KNP414_07569      CDS       T01550                                 

Definition
anthranilate synthase
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KNP414_07569
Enzymes [BR:pms01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     KNP414_07569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8265908..8267458)
Genome map
AA seq 516 aa AA seqDB search
MILTSLEQWQQWAGAYTVLPYIRRYALEETRPASWLGAWEQAAPGSFVLESGKGGRYTFL
GLQPRSEIRGRGLDMVISGPEGVVERGSLPPLEAVKRWMAPYRAPYVDGAPKWTGGCVGF
WGYDVIRTIERLPVQAAADLPLPDYAFVRVDELWIIDHQQSELFCAVSVYAPDQGDQELL
NRKYAEAAASAERMYELWNGLMASNQDQALAGELAEKKERMSRDLLQIDVDAIPGIQADF
PREAYVEAVRRIRDYIGAGDVFQVNLSVRQHKKLESTPEEIYEWLRLVNPSPYMGMLRFA
DFQLVSGSPELLVQLERGTVRTRPIAGTRPRGASPEEDRRLADELIHHEKERAEHIMLVD
LERNDLGRISKYGTVRVSDFMVIEYYSHVMHIVSEVEGELAQGKDAFDVIGAAFPGGTIT
GAPKIRTMEIIEELEPVRRGPYTGSIGWIDYNGDMEFNIIIRTLVVAEGTGYVQAGAGIV
IDSIPEKEYMESINKAKAMWKAIQYSEAEPVARRRG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgattctcacatctttggagcagtggcagcagtgggcgggagcctacaccgtgcttcct
tacatccgcaggtatgcactcgaagaaacccgtccggcgtcatggcttggggcttgggag
caggcggctcccggctccttcgtgctcgagagcggcaaggggggacggtatacgttcctg
ggcctgcagccccgctcggagatccggggaagaggacttgatatggtcatctcgggaccg
gaaggggtggtggagcggggcagtctgccgccgctcgaagcggtcaaacggtggatggct
ccctacagggctccttacgtggacggcgcacccaaatggaccgggggctgcgtaggcttt
tgggggtatgatgtgatccgtacgattgagcgtctgcccgtacaggctgccgcggacctg
cccctgccggattatgccttcgtccgggtggacgagctgtggatcatcgatcaccagcag
agtgagctgttctgcgcggtgtcggtgtacgcaccggatcagggtgatcaggagctcctg
aaccggaagtacgcagaagcggctgcgtcggccgagcggatgtacgagctgtggaacgga
ctcatggcctccaatcaggatcaggctctggcaggcgagctcgcggagaagaaggagcgg
atgagccgggatctactgcagatcgatgtggatgcgattcccggcatccaggccgatttt
ccacgcgaagcttatgtggaggctgtccgccggattcgggattacatcggggccggcgat
gtgttccaggtgaatctttccgtgcgccagcataagaagctcgagtccacgcctgaagag
atctacgagtggctccgcctggtgaatccgtcgccgtatatgggcatgctgcgcttcgcc
gacttccagctcgtctccggctctccggagctgctggttcagctcgagcggggaacggtg
cgcacgcgtccgattgcgggaacgcgcccacggggggccagcccggaggaagaccgtcgc
ctcgctgatgagctgattcatcatgagaaggaacgggctgagcatatcatgctcgtggat
ctggagcgtaacgacctgggcaggatctccaagtacgggacggtccgggtatcggatttt
atggtgatcgagtattactctcatgtgatgcatattgtctctgaggtcgaaggtgaactg
gctcagggcaaggatgcgttcgacgtcattggggcggccttcccgggaggaaccatcacg
ggggcgccgaagattcgcaccatggagattatcgaggaattggaacccgtgcgccggggc
ccttatacggggtccattgggtggattgactataacggcgatatggaatttaatattatt
atacgaaccttggttgtagcggaaggtaccggttatgtgcaggcgggagcaggcatcgtg
atcgattcgattccggaaaaagaatatatggagtccatcaacaaagccaaagcgatgtgg
aaagcgatccaatacagtgaagcggagccggtagcccgcaggaggggttaa

DBGET integrated database retrieval system