KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07658Help
Entry
KNP414_07658      CDS       T01550                                 

Gene name
speB
Definition
protein SpeB
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KNP414_07658 (speB)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KNP414_07658 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8345855..8346724)
Genome map
AA seq 289 aa AA seqDB search
MRLDQKYSGNVFILSSDDYAASRAVIYGMPMDYTVSFRPGSRFGPTRVREVSIGLEEYSP
YLDKSLEDITYFDAGDLLLPFGNAGRSLEIIGEYVKGLLDDNKFPFGLGGEHLVSWPVIQ
QMYAKYPDLAIIHFDAHADLRESYEGEPLSHSTPLRKAAGLMGGKNIYQFGIRSGSREEF
TYARENINFHPFEVLEPLKKRLPELAGRPVYLTIDIDVLDPSCAPGTGTAEPGGITSKEL
LDAIHAMAASDVNFVGADIVEVAPHYDHSEQTQIVASKVMREILLGLVK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgaccaaaaatattccggcaatgtgttcatcctgagctcggacgactatgcg
gcctcccgcgcggtcatctacggcatgccgatggactacacggtatcgttccgtcccggc
tcccgcttcggccctacgcgcgtgcgcgaagtgtcgatcggcctggaagaatacagccct
tatctcgataaaagcctggaagacatcacctacttcgatgccggcgatctgctgctgcct
ttcggcaacgcggggcgttcgctcgagatcatcggggagtatgtgaagggcctgctggac
gacaacaaattcccgttcggcctcggcggggagcacctggtctcctggccggtcattcag
cagatgtacgcgaagtacccggacctagcgatcattcactttgacgcccacgcggatctg
cgcgaatcgtacgagggcgagccgctctcgcactcgacgccgctgcgcaaggccgccggc
ctcatgggcggcaagaacatttatcagttcggaatccgttccggctcccgtgaagaattc
acgtatgcgcgcgagaacatcaacttccatccgttcgaagtgctcgagccgctgaagaag
cgtctgccggaactcgcgggccgtccggtctatctcacgattgacatcgacgtcctcgac
ccgtcctgcgcaccgggcaccggtaccgccgagccgggaggcatcacctcgaaggagctc
ctggatgccatccatgcgatggcggccagcgacgtcaacttcgtgggcgccgacatcgtc
gaagtggcgccgcattacgaccactcggagcagacgcagatcgtcgcatccaaggtgatg
cgcgagattctgctcggcctcgtgaaataa

DBGET integrated database retrieval system