KEGG   Prochlorococcus marinus MIT 9313: PMT0186Help
Entry
PMT0186           CDS       T00143                                 

Gene name
FPG
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pmt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(215736..216611)
Genome map
AA seq 291 aa AA seqDB search
MPELPEVETVRRGLADRLVDFQIGQVEVCRERAIASPGGSALFIKMLCGMHVGSWLRRGK
YLMASLHHEIAQSSADSEPDPDGGWWGVHLRMTGQFQWHEAISSPCPHTRVRIWNKKNEE
LRFVDTRSFGQMWWVPPGNAPETIITGLQKLGPEPFSSAFNSSYLSKRLKGSKRPIKSAL
LDQSIVAGAGNIYTDESLFAARIRPHTPSGQLKKVELERLCNCLTEVLRVSIGAGGTTFS
DFRDLEGINGNYGGQAWVYRRGGQACRICSTPIRRESLCGRGTHWCPNCQR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaattacctgaagttgagacggtccgccgcggattggcagaccgtcttgttgat
tttcagatcggccaggttgaggtttgccgagaacgagccatagcaagccctggcggttct
gccctatttatcaagatgctctgcggcatgcacgtgggctcatggttaagacgcggcaag
tacttaatggcgtctttacatcatgaaattgcccagtcatcagctgattcagaacctgat
cctgatggtggatggtggggcgttcacctgcgcatgacaggacaatttcaatggcatgag
gccatcagttcaccctgcccgcatacacgcgtacgcatctggaacaaaaaaaatgaggaa
ctgcgcttcgttgacacgcgcagcttcggacaaatgtggtgggttccacctggcaacgcc
ccggaaacaatcatcacaggactgcaaaaacttgggccagaaccattcagcagcgccttc
aattcctcatacctaagcaaacgcttgaagggttcgaaacgaccaatcaagtcagcactt
ttggatcaatccatcgtggcaggggcaggaaacatctataccgatgaaagcctttttgca
gccagaatccgtccccacactccatcaggtcaattaaaaaaggtcgagcttgaacgctta
tgcaactgcctcacggaggtcctcagagtgagcatcggtgctggaggaacaaccttcagc
gacttcagagatcttgaaggcattaacggcaactacggtggtcaagcctgggtgtatcgc
agaggaggccaagcctgccggatatgcagcacgcccatccgccgtgaaagcctttgcggt
cgtggcacccactggtgccccaattgccaacgatga

DBGET integrated database retrieval system