KEGG   Prochlorococcus marinus MIT 9313: PMT0373Help
Entry
PMT0373           CDS       T00143                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PMT0373
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PMT0373
Enzymes [BR:pmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PMT0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
419186..421699
Genome map
AA seq 837 aa AA seqDB search
MALFGFSAFRSLLKRGSSLKPWSVPAASWSRAFGLPWQQPYTVRYASNLDDGPWHGMPLG
GFGAGCIGRSPRGDFNLWNLDGGEHWQGSIPDCQFALFERQGDQVRAHALATAPQTDDSQ
PELDKPLSSWSWYPASTEQRKTGSYSARYPLSWTHYKGVFAAELVCEAFSPILPGDYRRT
SYPLAVFRWQLQNPTSQSLELSLLLSWRNTCGWFTNTDPSASVHFRDDGSPEHSYVPAIG
RGEGQCNRWIDQPGLIGVLMEGERADPLAEGQGQWCLAVPDHLPGVEVMRCSRWDPSGDG
SELWSSFASEGTIPNSNTAHKSLAGEQTSAALAVKVTLAPGESLEIPVVISWDLPVTAFA
TGVRDLRRYTDFHGSDGQAAAALAAEALSDWSDWREQIDAWQAPVLAREDLPERLRMALF
NELYDLASGGSLWTAARPGDPVGRFGVLECFDYAWYESLDVRLYGSLALLQLWPELDKAV
LRSFARAIPAADATPRPIGWYFTQGRGRVEAPRKRAAATPHDLGAPNESPFDATNYTAYQ
DCNLWKDLASDYVLQVWRTFLLSPNGEDLSFLAECWPAVVQALSYLKRFDVNHDGLPDNG
GAPDQTFDDWPLQGVSAYCGALWIAALEAALAMAQRLQLDLGLNTAEEQHQFSGWLEQSR
VNFDRLLWNGEYYKIDAESGTPVVMADQLCGDFYARLLGLPSVVADERSRSSLNAVKEAC
FEGFEGGRLGVANGLCRDGMPLDPKGTHPLEVWTGINFGLAAYYRLMGDATTATAICSAV
VNQVYGGGLQFRTPEAITAVKTYRACHYLRAMAIWALWATHTDWQLIPGAERAGSEW
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccctttttggcttttcagctttcagatccttgttgaagcgtggatcgagcttgaag
ccttggagtgtgcctgccgccagctggagccgtgcttttggattgccttggcaacagcct
tacacggtgcgttatgccagcaatctcgatgatgggccctggcatggcatgcccctggga
ggcttcggggccggttgtatcgggcgtagcccacgcggtgatttcaatctctggaatctt
gatggtggtgagcattggcagggcagcattcctgattgccagttcgctttgtttgagcgg
cagggggatcaggtgcgtgctcatgcgctggctacagcgccacaaaccgatgactctcag
cctgagctagacaagcctctctcctcttggagctggtatccagccagtacagagcaacgc
aagactggtagctattcagcccgctatccgctcagttggacccattacaaaggagtcttc
gcggctgagctggtttgcgaagcgtttagtccaatccttcctggtgattaccgacgcacg
agctaccccctggccgtgtttcgttggcagctgcagaacccaacatcgcaatctctggaa
ttgtcgctgctgctgagttggcgcaacacatgtggctggttcacaaacaccgatccctcg
gccagcgtgcatttccgcgatgatgggagccctgaacacagttatgtgcctgccatcggc
cgtggcgaggggcagtgcaatcgttggattgatcagccagggctgattggtgtcttgatg
gagggtgagcgagctgacccattggctgagggccaagggcagtggtgtttggctgttcct
gatcatctgcctggagtggaggtgatgcgttgtagccgttgggatcccagcggagatggc
agcgaactgtggagttccttcgcaagtgaaggaaccattccaaacagcaataccgcacac
aagagcttggcgggggagcagaccagcgctgctttagcggtgaaggtcaccctggcacct
ggcgaaagtcttgagatccctgtggtgatcagttgggatctaccggtgacggctttcgct
acaggcgttcgcgatttgcgtcgttataccgactttcatggcagcgatggtcaggcggcc
gccgctcttgctgcagaagccctgagtgattggtctgattggcgtgagcagattgatgcc
tggcaagcaccggtgctggctcgtgaggatctgccggagcgcttgcgaatggctttgttc
aatgagctctacgacttggctagcggtggcagcctttggacggcagcccgtccaggagat
ccggtgggtcgctttggggttcttgagtgcttcgactacgcctggtacgaaagtcttgat
gtgcgcctctatggctccttggctttgctgcagttgtggcctgagctcgataaggccgtc
ttgcgtagttttgctcgagccattccagcggcagatgccacgccacgaccaattggctgg
tacttcacccaggggcgtggccgggtcgaggccccccgaaagagggcggcggctactccc
catgatctgggagcaccgaatgagtcgccgtttgatgccaccaactacaccgcttatcag
gattgcaatctctggaaagatctggccagtgattatgtgttgcaggtatggcgaacgttt
cttctctcaccgaatggtgaagatctgagcttcttggctgaatgctggccggcggtagtg
caagccctcagttatctcaagcggtttgatgtcaatcacgatggtctgcctgataacggt
ggtgctccggatcagacctttgacgattggcctttacaaggcgtgagcgcctattgcggt
gctctttggattgcagctcttgaggctgctctagccatggcacagcgcttgcaattggac
ttagggctgaatacggcagaggagcaacatcagttcagcggttggcttgagcaatcacgg
gtcaacttcgatcggctgctttggaatggggagtattacaagatcgatgctgagagtggt
acgcccgtggtgatggctgatcaactctgtggtgatttctatgcacgcttgctggggctg
ccctctgttgttgctgatgaacgcagtcgcagcagtctgaatgcagtcaaagaggcctgc
tttgaaggctttgaaggcggccgtttgggagttgccaatggtttgtgccgtgatggcatg
ccacttgatcccaagggaacccatcccttggaggtatggactggtatcaacttcggtttg
gcggcctactaccgattgatgggcgatgcaacgacggccacagccatctgttccgcggtg
gttaatcaggtgtatggcggtggcttgcagttccgcaccccagaagcgattactgcagtg
aagacctatagggcttgccactatttgcgtgcaatggcgatctgggccctgtgggcaacg
catacggattggcagttgattccaggtgccgaacgggcagggtctgagtggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system