KEGG   Prochlorococcus marinus MIT 9313: PMT0389Help
Entry
PMT0389           CDS       T00143                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMT0389 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT0389 (acs)
   00620 Pyruvate metabolism
    PMT0389 (acs)
   00640 Propanoate metabolism
    PMT0389 (acs)
  Energy metabolism
   00680 Methane metabolism
    PMT0389 (acs)
Enzymes [BR:pmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMT0389 (acs)
Lipid biosynthesis proteins [BR:pmt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMT0389 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(436940..438916)
Genome map
AA seq 658 aa AA seqDB search
MSPDPSGTIKSVLQEQRVFHPSAELASQSMVGSLEAYRRMAEQAKTDPDSFWGEAARTEL
EWFEPFDSVLDWSNPPFARWFEGGTTNLSFNCLDRHLNGPKANKTALIWEGEPGDVRRFT
YRELHAEVCRAANALKALGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSAE
ALRDRLVDGEAKAVITADGGFRKDKAVALKPAVDAALAEGACPSVTSVLVVQRTKESVVM
EAGRDQWWHELVSAQSQECAAEPMASEDRLFVLYTSGSTGKPKGVVHSTAGYNLWAHLTF
KWIFDIRDEDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWELIQKH
GITIFYTAPTAIRAFMKSGRAVPDQYDMSSLRLLGTVGEPINPEAWMWYREVIGGDRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATLPLPGIEAEVVDAQGEPVAVDEGGYLIVRRP
WPGMMRTVHGNPQRFRESYWEYLRPKDGSFIYFAGDGARRDGDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHPAVSEAAVVGRPDDLKGEAIVAFVTLEGSREVSDALIQELRVHVG
KEIGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEEVKGDTSTLEDRSVLDRLRA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgatccatccggcaccattaagtcagtcctgcaggagcagcgcgtctttcat
ccctccgcagagttggcctcacagtcgatggttggaagcctggaagcctatcgtcggatg
gcagagcaagccaaaactgatcctgacagtttctggggtgaagccgctcgcactgagctg
gaatggttcgaaccctttgatagcgttctcgattggtcgaatcctccctttgcgcgttgg
tttgaaggaggcacgacaaatctttccttcaactgtcttgatcgccatctcaatgggccg
aaggcaaacaaaacagccctgatctgggagggagagccaggtgatgtgcggcgcttcacc
tatcgagaacttcatgctgaagtgtgcagggctgccaatgcgctgaaagctcttggcatt
ggcaaaggtgacctggttgccctttatatgccaatggtcccagaagcggccattgccatg
ttggcttgcgcccgtatcggagccccacattctgttgtctttggtggcttttccgctgaa
gcccttagagatcgtttggtggatggtgaagccaaagccgtgatcactgctgatggtggt
tttcgtaaggacaaggccgttgccttgaagccggcagtggatgctgcattagccgagggt
gcctgccccagcgtgacgtcggtgctggtggtgcaacgcacgaaagaaagcgtggtgatg
gaagctggtcgagatcagtggtggcacgagcttgtgtcagctcaatcgcaagagtgcgcg
gcggaacccatggcgagtgaagatcgcctgtttgtgctctacacctctggctccactgga
aagccaaagggcgttgtgcacagcacggcaggctataacctctgggctcacctcactttc
aagtggatcttcgacattcgcgacgaagacgtctactggtgcacagccgatgtgggctgg
atcacaggccatagctacattgtttatgggcctctttccaatggggcgacaactgtgatg
tatgagggggcaccacgcccatccaagcctggagccttttgggagctaattcagaaacac
gggatcacgattttttacactgcacctacggcaattcgggcattcatgaaaagtggtcgg
gctgtacccgatcaatacgacatgagcagtctgcgcttgctaggtaccgtcggagaaccc
atcaatcctgaggcctggatgtggtatcgcgaggtcatcggtggtgatcgttgcccaatt
gtcgacacttggtggcaaacggagacaggtggggtgatgatcagcccattacctggtgcg
acgccaacaaagccagggtctgcgacccttcccctaccaggcattgaggctgaggtggtt
gatgcacaaggcgagccagtagccgttgacgaaggtggatatctgatcgtgcgacgtcct
tggccaggaatgatgcgcaccgtgcacggaaatcctcaacgctttagagagagctattgg
gaatacttacgccctaaggatggcagtttcatctatttcgcaggcgatggagctcgtcga
gatggtgatggttatttctgggtgatgggcagggtggatgatgtgattaacgtttcaggc
catcgtcttggcacgatggaaatcgaatcggcattggtgagtcacccggcagtgtctgaa
gcggcagtggttggaagacctgatgaccttaaaggtgaagcgatcgtggccttcgtcacc
ttggaaggaagcagggaagtgagtgatgctttgattcaggagcttcgtgttcatgtgggc
aaggagatcggccccattgctcgacctgatgagatccgttgcagtgatgccttacccaag
acccgcagcggcaaaattatgcggcgtatcttgcgggctttggccgctggagaggaggtc
aagggtgataccagcaccctggaagatcgctccgtactggatcggcttagagcctga

DBGET integrated database retrieval system