KEGG   Prochlorococcus marinus MIT 9313: PMT0425Help
Entry
PMT0425           CDS       T00143                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMT0425
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT0425
   00052 Galactose metabolism
    PMT0425
   00500 Starch and sucrose metabolism
    PMT0425
   00520 Amino sugar and nucleotide sugar metabolism
    PMT0425
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMT0425
   00524 Butirosin and neomycin biosynthesis
    PMT0425
Enzymes [BR:pmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PMT0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
476670..477731
Genome map
AA seq 353 aa AA seqDB search
MPSPRTFLAGDLGGTKTLLALYSWDEKQLKQQHRRRYLSNQWTSLEPMLSHFIAHLPGEM
EQPNNGCIAVAGSVRHGEARITNLPWSLKEKDLCSATGLKHLELINDFGVLIYGLPFLND
AQQVELQRPQQHLSAQGPIAVLGAGTGLGMARGLPTKDGMVALPSEGGHREFAPRSECEW
QLCEWLKADLQLERLSLERVVSGTGLGHVARWRLQHSDADGHPLRGLADAWRHGANDHCD
HLDLPALASQAASEGDSILQEALQLWLAAYGSAAGDLALQELCVGGLWVGGGTAAKQLQG
LRSSTFLEAFRNKGRFRPFLEQLPVMAVIDPEVGLFSAACRAHMLAEQGGTLT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccccgagaacctttctggcaggtgatttggggggcaccaaaaccttgcttgcg
ctctatagctgggacgaaaagcaactcaagcaacagcaccggcggaggtatttatccaat
cagtggacttcgcttgaacccatgctgagccacttcatcgcccatttgccaggggagatg
gagcaacccaataacggctgcatcgctgttgcaggatcggttcgccatggtgaggcacgt
atcaccaatctgccctggagcctgaaggagaaggacctttgctcagccacgggactgaag
catttggaactgattaatgactttggcgtattgatctacggcctaccctttctcaacgac
gcgcagcaggtggagcttcagcgtccacagcagcatttgtctgcacaaggacccattgca
gttctgggggcaggtactggacttggaatggcccgtggcctgcccacaaaagatgggatg
gtggcgctgcccagtgaaggcggacaccgtgaatttgctcctcgcagtgaatgcgagtgg
caactttgtgagtggctcaaggccgatttgcagctcgaacgcctttcattggaacgtgtt
gtcagtggaacgggcctgggacacgtggcgcgctggcgcctacagcacagtgacgcagat
ggtcatcctctgcgaggtctggccgatgcttggcgccatggtgctaatgatcattgcgac
catttggatctgcctgctcttgctagtcaagccgcaagcgaaggcgattcaattcttcaa
gaagccttacagctctggctcgctgcttacggctctgctgcgggagatttagctctgcag
gaactctgtgtcggaggcctctgggtgggtgggggtaccgctgcgaagcagcttcaaggt
cttcgctcaagcacctttcttgaagccttccgcaacaaggggcgcttccgtccgtttcta
gagcaattgccagtgatggcagtgatcgatcccgaggtgggcctgttcagtgcagcctgc
agagcacacatgcttgctgagcaaggtgggacactgacctaa

DBGET integrated database retrieval system