KEGG   Prochlorococcus marinus MIT 9313: PMT0465Help
Entry
PMT0465           CDS       T00143                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT0465 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT0465 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMT0465 (trpA)
Enzymes [BR:pmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMT0465 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(517240..518067)
Genome map
AA seq 275 aa AA seqDB search
MADFLAPKSNTHATISSRFQRVQAEGRLALMPFLMAGDPDLETTAEVLLSLEQSGADMIE
LGIPYSDPLADGPVIQAAASRALASGTTPARVLQMLIDLRGKLSIPVILFTYTNPLFNRG
MERFCDEAAEAGVAGLVVPDLPLEEAERLSPLASARGLDLVLLVAPTTPAERMARIAESS
RGFTYLVSVTGVTGERSVMEDRVQSLVQQLKLSGSNPVAVGFGISGPQQVRQVRSWGADG
AIVGSALVKRMAAAAPGLVAQEAGLFCKELRNAAG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttcttggcacctaaatccaatacacacgccacaatcagcagtcgcttccaa
cgagtacaagctgagggacgccttgcactcatgccattcctcatggctggtgatcctgat
ctggaaaccactgctgaggtattgctcagcctggagcaatctggcgcggacatgatcgag
ctgggcattccctatagcgatcctctcgccgatggtccggtaattcaggcagctgcttct
cgagcactggcttctggtacgacaccagctcgggtcttgcagatgttgattgacttgcga
ggcaaactttccattcctgtgatcctgttcacctacaccaatccattgttcaaccggggt
atggagcgtttctgtgatgaagctgctgaggctggagttgccggtcttgtggtcccagat
cttccactcgaggaagctgagcgcctttcccccttggcttctgctcgtggacttgatctg
gttcttctggtggctcctactacacctgcggagcgtatggcaaggattgcagaaagcagc
aggggttttacctatttagtaagcgtgacgggagttactggcgaacgttctgtaatggag
gatcgtgttcaatccttggtgcagcaactcaagttgtccggctccaatcctgtagcagtc
ggatttggaatttctgggcctcagcaagtacggcaggtgcgaagttggggtgctgatgga
gccattgttggcagtgctctagtgaaacgaatggctgctgcggctcctggattagttgct
caagaagcgggtcttttctgcaaggagctgcgcaacgctgctggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system