KEGG   Prochlorococcus marinus MIT 9313: PMT0529Help
Entry
PMT0529           CDS       T00143                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
576861..577946
Genome map
AA seq 361 aa AA seqDB search
MSLWVVKVGTSLLRGNEKQSTAEVIESYSACLSASLKRGDHVVLVTSGAVGLGCNRLGLS
QRPVDVVALQGTAAIGQGQLMALYEAAMSRRGHTVAQVLLTRSDLGSRQRYRNASSTLKQ
LLDWGVLPVVNENDALSPEELRYGDNDTLSALVATAVEADQLIMLTDVDRLYSSDPRINA
SAEPISDVYHPHELTALEVAAGEGGAWGTGGMTTKLAAARIATASGITVLLADGRDPQVL
DGLLQGRRSGTVFHPHPQPLGNRKSWLAHALKPLGTLQLDEGACDALQHRGASLLLVGVK
EVEGNFEANQPVRLINPEGNELARGLCSLSSKELREAIETQMSTNRSPVVVHRDVLVLRN
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtgggtggtgaaggtgggaaccagcctgctgagaggcaatgagaagcaatcc
accgccgaagtgattgagagctacagcgcctgcctttcagcaagcctcaagcggggggat
catgttgtcctcgtaacaagtggcgccgtaggtcttggttgtaatcgtctagggctaagc
caacggccggtcgatgtggtggctctccaagggacggcggcgatcggtcaaggacaactc
atggctctttatgaggctgccatgagccgaaggggtcacaccgtggctcaggtattgctt
acccgctcagatcttggctccaggcagcgataccgcaatgcttctagcaccttgaagcaa
ttgctcgactggggcgttctgccggtggtgaatgagaacgacgccctctctccggaagaa
ttgcgatacggcgacaacgacaccctttcagctctcgttgcaaccgcagtggaggctgat
cagctcatcatgctcaccgacgtggatcgcctttattcctcagacccccgcattaatgcc
tctgccgaaccgatctcagatgtttaccatccccatgaactgactgccctggaagtcgcg
gcaggggagggaggtgcctggggcactgggggcatgactacaaaacttgcggcagctcgc
atcgctaccgcaagtggcatcaccgttcttcttgctgatggccgcgatcctcaagtgctt
gatgggttgctgcaaggaagacggagcggcacggtgtttcatcctcaccctcaacctctc
ggcaatcgcaagagctggctggcccatgctctgaagcccttagggacccttcagctggat
gaaggcgcctgcgatgcccttcaacatcgtggcgcctccctgctcttggtgggggttaaa
gaggtggaaggaaactttgaagccaaccagccggtaagactaattaatcccgaaggtaac
gagctcgctcgaggcctgtgttccttgagtagcaaagaactgcgcgaggccattgagacc
caaatgagcacgaatcgttcaccggtcgtggtgcatagggacgtgttggttctccgcaac
gcgtga

DBGET integrated database retrieval system