KEGG   Prochlorococcus marinus MIT 9313: PMT0644Help
Entry
PMT0644           CDS       T00143                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMT0644 (ruvA)
Enzymes [BR:pmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMT0644 (ruvA)
DNA repair and recombination proteins [BR:pmt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PMT0644 (ruvA)
    RecFOR pathway proteins
     PMT0644 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
Position
697936..698613
Genome map
AA seq 225 aa AA seqDB search
MIGWLQGQKVEAWQQGTRQGVVLACAGVGYEVQIAPRHLSEMEHGQNTFILWIHQVQRDD
GSSLFGFPERRERDMFRTLIGVSGVGPQMALALLEECQTGELVEAIVQGDLRKLCQAQGV
GKRTAERLAVELRTKLAEFSCRDPGMSLVDNGVIDSHQLKDSSLHELQITLGGLGYEDLE
IRRAIRAVASGAAIGASDMPESVPSIDDTDAWLRASLRWLSQEAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattggctggctgcaagggcaaaaggtagaagcctggcagcaagggactcggcaagga
gtcgttctggcttgtgctggtgttggttacgaggttcagattgcaccgcgccatctcagc
gaaatggagcacgggcaaaacacattcatcctctggatccatcaggtgcagcgtgatgat
ggatccagcttgtttggcttcccggaacgacgagaacgggacatgtttcgtaccttgatt
ggtgtcagcggcgtggggccccagatggctctcgctcttctagaggaatgtcagaccgga
gaacttgtagaggcgattgtgcagggagacctacgcaagctttgtcaggctcaaggtgta
ggcaagcgcactgccgaacgtcttgcggtggaattgcgcacaaagttggctgaatttagt
tgtcgtgatcctggaatgtccctggtggacaatggtgtgatcgattcgcatcagctcaag
gattcaagtctgcatgagctacagatcaccctcgggggccttggctacgaagatcttgaa
atacgccgtgccataagggctgtggccagcggtgctgcaataggagccagtgacatgcct
gagtctgtcccttccatcgacgacactgacgcctggctgagagcaagcctgcgctggctt
agtcaggaagctgcctaa

DBGET integrated database retrieval system