KEGG   Prochlorococcus marinus MIT 9313: PMT0644Help
Entry
PMT0644           CDS       T00143                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMT0644 (ruvA)
Enzymes [BR:pmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMT0644 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
697936..698613
Genome map
AA seq 225 aa AA seqDB search
MIGWLQGQKVEAWQQGTRQGVVLACAGVGYEVQIAPRHLSEMEHGQNTFILWIHQVQRDD
GSSLFGFPERRERDMFRTLIGVSGVGPQMALALLEECQTGELVEAIVQGDLRKLCQAQGV
GKRTAERLAVELRTKLAEFSCRDPGMSLVDNGVIDSHQLKDSSLHELQITLGGLGYEDLE
IRRAIRAVASGAAIGASDMPESVPSIDDTDAWLRASLRWLSQEAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattggctggctgcaagggcaaaaggtagaagcctggcagcaagggactcggcaagga
gtcgttctggcttgtgctggtgttggttacgaggttcagattgcaccgcgccatctcagc
gaaatggagcacgggcaaaacacattcatcctctggatccatcaggtgcagcgtgatgat
ggatccagcttgtttggcttcccggaacgacgagaacgggacatgtttcgtaccttgatt
ggtgtcagcggcgtggggccccagatggctctcgctcttctagaggaatgtcagaccgga
gaacttgtagaggcgattgtgcagggagacctacgcaagctttgtcaggctcaaggtgta
ggcaagcgcactgccgaacgtcttgcggtggaattgcgcacaaagttggctgaatttagt
tgtcgtgatcctggaatgtccctggtggacaatggtgtgatcgattcgcatcagctcaag
gattcaagtctgcatgagctacagatcaccctcgggggccttggctacgaagatcttgaa
atacgccgtgccataagggctgtggccagcggtgctgcaataggagccagtgacatgcct
gagtctgtcccttccatcgacgacactgacgcctggctgagagcaagcctgcgctggctt
agtcaggaagctgcctaa

DBGET integrated database retrieval system