KEGG   Prochlorococcus marinus MIT 9313: PMT0644Help
Entry
PMT0644           CDS       T00143                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
697936..698613
Genome map
AA seq 225 aa AA seqDB search
MIGWLQGQKVEAWQQGTRQGVVLACAGVGYEVQIAPRHLSEMEHGQNTFILWIHQVQRDD
GSSLFGFPERRERDMFRTLIGVSGVGPQMALALLEECQTGELVEAIVQGDLRKLCQAQGV
GKRTAERLAVELRTKLAEFSCRDPGMSLVDNGVIDSHQLKDSSLHELQITLGGLGYEDLE
IRRAIRAVASGAAIGASDMPESVPSIDDTDAWLRASLRWLSQEAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattggctggctgcaagggcaaaaggtagaagcctggcagcaagggactcggcaagga
gtcgttctggcttgtgctggtgttggttacgaggttcagattgcaccgcgccatctcagc
gaaatggagcacgggcaaaacacattcatcctctggatccatcaggtgcagcgtgatgat
ggatccagcttgtttggcttcccggaacgacgagaacgggacatgtttcgtaccttgatt
ggtgtcagcggcgtggggccccagatggctctcgctcttctagaggaatgtcagaccgga
gaacttgtagaggcgattgtgcagggagacctacgcaagctttgtcaggctcaaggtgta
ggcaagcgcactgccgaacgtcttgcggtggaattgcgcacaaagttggctgaatttagt
tgtcgtgatcctggaatgtccctggtggacaatggtgtgatcgattcgcatcagctcaag
gattcaagtctgcatgagctacagatcaccctcgggggccttggctacgaagatcttgaa
atacgccgtgccataagggctgtggccagcggtgctgcaataggagccagtgacatgcct
gagtctgtcccttccatcgacgacactgacgcctggctgagagcaagcctgcgctggctt
agtcaggaagctgcctaa

DBGET integrated database retrieval system