KEGG   Prochlorococcus marinus MIT 9313: PMT0815Help
Entry
PMT0815           CDS       T00143                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT0815 (chlH)
Enzymes [BR:pmt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT0815 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
889570..893613
Genome map
AA seq 1347 aa AA seqDB search
MFTQVRSADRRVAPAENHSHQAVMKAVYLVLEPQYQSALSQAANSLNAQNGAIGVELSGY
LIEELRDPSNFADFQADVAEADVFIASLIFIEDLAQKVVDAVTPHRERLKAIVVFPSMPE
VMRLNKLGTFTMAQLGQSDSVIANFMKKRKESNGAGFQDAMLKLLNTLPNVLKYLPVDKA
QDARSFVLSFQYWLGGTPDNLRNFLLMLADKYVFPATEGEDRPKLDIVEPEIFPDLGIWH
PMAPSMFEDLKEYLNWTTSRTDLSEKARKGPMIGLVLQRSHIVTGDDAHYVAVIQELEFR
GARVLPIFCGGLDFSKPVNAFFFDPVNPDQPLVDGVVSLTGFALVGGPARQDHPKAIESL
KRLSRPYMVALPLVFQTTQEWEVSDLGLHPVQVALQIAIPELDGAIEPIVLSGRDDATGK
AHTLQDRVDAIAERAIRWSSLRIKSRAEKKLAITIFSFPPDKGNVGSAAYLDVFGSIHRV
LEEMKAQGYDIQNLPKDSKALMEAVINDPEALEGAPELAIAHRMSVAEYEHLTPYSERLE
ENWGKPPGELNSDGQNLLIYGRHFGNIFVGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYLEKIWKADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGGLPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYKGLKELGELVGSYQQLREGGRGVQIVNTIIETARQCN
LDRDVDLPEQDAAELDLDQRDAVVGAVYSQLMEIESRLLPCGLHTIGKPPTAEEAIATLV
SIAALEREDDGLRSLPGLLAEAIDRKIEDIYKGNDDGILADVELNRTITEASRVAVRAMV
QSLTGRDGRVNMKDNSNWYLDWFFNLLQRFGVTRPNAWLQACRKAGFGNIDSIELDKLFS
YLRGCLEKICADMEMQSLLRALDGEYVLPGPGGDPIRNPGVLPSGKNIHALDPQAIPTRA
AVAAAKGVVDKLIERQRQEQGDWPETIACVLWGTDNIKTYGESLAQILWFIGVNPVPDSV
GRVNKLKLIPLEELGRPRIDVVVNCSGVFRDLFINQMALIDQGVKMAAEADEPLDQNFVR
KHSLEQAKEQGTSLRDAACRVFSNSSGSYSSNVNLAVENSTWEEENELQEMYLSRKTFAF
NADNPGEMNQNREVFESVMKTADVTFQNLDSAEISLTDVSHYFDSDPTNLIKGLRDDGKA
PASYIADTTTANAQVRSLSETIRLDSRTKLLNPKWYEGMVNSGYEGVREVAKRLNFTLGW
SATSGQVDNFVYEESNETFINDPEMRKRLMELNPHSFRRIVGTLLEVNGRGYWETSDENI
QQLQELYQEIEDRIEGVTTPDNQSSGE
NT seq 4044 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgcaggttcgctcagccgatcgccgagttgctcctgcggagaaccacagccat
caagctgtcatgaaagcggtgtatttggtactcgaacctcagtaccaaagtgcgctttcc
caggccgcaaacagcctcaatgcacaaaatggagccattggcgttgaactgagtggttac
ctcatcgaagaactgcgcgatccaagcaactttgcagacttccaagccgatgtagccgaa
gccgatgtttttatcgcctcgctgattttcattgaagacctagctcagaaagtggtggac
gctgtcaccccccatcgcgagcggctcaaagccattgttgttttcccttccatgccagag
gtgatgcggctcaacaagcttggcaccttcaccatggcccagctgggacagagcgatagt
gttatcgccaacttcatgaaaaagcgaaaggaatcaaacggtgctggattccaagacgca
atgctcaaactattaaatacactccccaacgttcttaaatatctgccggttgataaagca
caagatgcaagaagcttcgtgctcagctttcaatactggctaggaggtacgcctgacaac
ctacgcaacttcctattaatgctggcggataagtatgtctttccagcgacagaaggagaa
gatcgtccaaaactagacatcgtggagccagagatcttcccagacctgggcatctggcat
ccgatggccccgtcgatgtttgaagacctcaaggagtacctcaactggacgaccagccgc
acagatctctcagagaaagctcgcaaaggcccaatgatcggtcttgtcctgcagcgaagc
cacattgtcactggtgacgatgcccactatgtcgctgtcattcaagagcttgagttccgt
ggtgcacgtgtcctccccattttctgcggtgggcttgatttctctaagcctgtcaatgcc
ttctttttcgacccagtcaaccctgaccaacccctagtcgatggggtggtttccctcact
ggatttgcccttgtaggtggccctgccagacaggatcaccccaaggctatcgaatctctc
aagcgccttagccgcccttatatggttgcgctcccgcttgtcttccagacaactcaggaa
tgggaagttagtgacttaggcctgcatccagttcaggttgcactacaaatcgccatcccc
gaattagacggagccatcgagccaatcgtgctctctggtagggatgatgccaccggcaaa
gcccacacacttcaagaccgggttgatgcgattgctgaacgagcaatccgttggtcatct
ctaagaatcaaatcaagagctgagaaaaaattagcaattactatttttagtttccctcca
gataaaggaaatgttggcagtgctgcctacctcgatgtttttggttccatccatcgtgtt
ttggaggaaatgaaggctcagggctacgacatccaaaacctccccaaagactccaaagca
ctgatggaggcggtaatcaatgatcctgaagcactagaaggagcaccagaactggccatt
gcacaccgaatgagtgtggctgagtacgagcacctgacaccttattcagagcgccttgaa
gaaaactggggcaagccgccaggagaactcaatagtgatggtcaaaacctactgatctat
ggacgtcacttcggcaacatctttgtaggcgttcaacccaccttcggctacgaaggagac
ccaatgcgcttgctctactcaagaagcgccagtcctcatcacggctttgctgcttactac
acctatctcgaaaagatctggaaagctgatgctgtgctccattttggcacccacggatct
ctcgaattcatgccaggcaagcagatgggcatgagtgaaacctgctatccagattcattg
atcggagggctgccaaatctttattactacgcagcaaacaatccctccgaagcaacgatt
gcaaaaaggcgtggttatgcctccacaatcagctacctcactcctccagcagaaaatgca
ggactttacaaaggtctaaaagagctaggcgaactggtgggttcctaccaacaactgcgt
gaaggcggtcgtggtgtgcaaatcgtcaataccatcattgaaaccgcacgccaatgcaat
cttgatcgcgacgtagacctgccagaacaagacgcggcagagctagatctcgaccaacgg
gatgccgttgtaggcgcggtgtatagccaattgatggaaatcgagagtcgccttctgcca
tgtggacttcacacgatcggcaaaccacccacggcagaagaagcgatagcgactctggta
agcatcgccgcccttgaacgtgaagacgacggtcttcgctcgcttcctgggctgttagca
gaagcaatagatcgcaaaatagaagatatttacaaaggaaatgatgacggcattcttgct
gatgtagagctaaatcgcactatcactgaggcatctcgtgtcgccgttagggcgatggtg
caatctctcactggacgagacggacgcgtgaatatgaaagataattccaactggtatttg
gattggttttttaatctacttcagcgttttggtgtaacacgccccaatgcatggctgcaa
gcctgtagaaaagctggattcggcaacattgattccattgagcttgacaaactgttttct
tatttgcgcggttgccttgaaaagatatgcgcagacatggaaatgcagagccttctgcgt
gccctcgatggagaatatgtgcttcctggtccaggtggagacccaattagaaatccaggg
gttctgccaagtggcaaaaacattcacgctctcgatccacaggccattcctaccagagct
gccgttgctgcagcaaaaggagtcgtcgataaattaattgaacgtcaacgccaagaacag
ggtgattggccagaaacaattgcctgtgttctttggggtacagataacatcaaaacctac
ggcgaatcacttgcgcaaattctctggtttattggtgtaaatccagtaccagactctgta
ggccgtgttaacaagctaaaactcattccccttgaagagcttggtcgaccaaggattgat
gtggttgtgaactgttcaggagtatttcgagatctgtttatcaaccaaatggcattaatc
gatcaaggcgtcaagatggcagctgaggccgatgaaccactggatcaaaacttcgtacgc
aaacactcccttgaacaagcaaaggaacaaggcacaagccttagggatgccgcttgccgt
gtattttctaattcaagtggaagttatagctcaaacgtaaatcttgcagtagagaactca
acatgggaagaagagaatgaacttcaagagatgtatctttcacgcaagacatttgccttt
aatgctgacaacccaggagagatgaaccaaaacagagaagtatttgaatctgttatgaaa
acagcagatgtcactttccaaaaccttgattctgctgaaatttcgcttactgatgtcagc
cactacttcgactcagaccccacaaatttaatcaagggtcttagagatgatggcaaagct
cccgccagttacatcgcagatacaacaacagcaaatgcgcaggtccgctcactgagcgaa
acgattcgattggattcccgtacaaagctacttaatccaaaatggtatgaaggcatggtc
aactcaggctatgaaggcgttcgcgaagtcgccaagcgcctgaactttaccctcggctgg
agcgcaactagcggacaggtagataactttgtctacgaagagtcaaacgaaaccttcatc
aatgatccagagatgcgtaagcgtctcatggaacttaatccacatagtttccgtcgtatt
gttggcaccttattagaagttaatggcagaggttactgggaaacatctgatgagaatatt
cagcaattgcaagagctttaccaggaaattgaagatcgaattgaaggagtaacaacgcca
gacaaccaatcgtctggcgaatga

DBGET integrated database retrieval system