KEGG   Prochlorococcus marinus MIT 9313: PMT0910Help
Entry
PMT0910           CDS       T00143                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMT0910
Enzymes [BR:pmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PMT0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(993667..994536)
Genome map
AA seq 289 aa AA seqDB search
MSESITMNLLEPQDLPDLPKLKLAVVGHVEWVTFLSTDQLPQPGVISHADHSFEEPAGGG
AVVAVQLARLVKQPVQFITALGRDSCGEKSFQRLQQLGLSLTVAWRDQPTRRAISLVDSH
GERAITVIGERLQPRAKDALGWGALAGYDGVFVTAADAPALHHCRHAGVMAATPRVRLET
LEQANIQLDALIGSGLDPGEHVPDKALFPTPRLRIATEGALGGQLWPGGRYQAVSLKSPV
VDAYGCGDSFAAGVTAGLAAGWTDEQAISLGAHCGASCATHFGPYSSDE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaatcaatcaccatgaatctcttggaaccccaggatctgccagatcttcccaag
ctgaagttggccgttgtgggccacgttgaatgggtgaccttcctgtctacagatcaatta
ccccagcctggggtaatcagccatgcagatcattcttttgaagagcccgctggcggtgga
gctgtcgtcgcggtgcaattggctcggctcgttaaacaacccgttcaattcataacagct
ctaggtcgagattcatgcggtgaaaagagttttcaaagactccagcagcttggcttaagc
ctgactgtggcttggcgtgatcaacccactcgtcgggcgatcagccttgttgattctcat
ggggaacgggcaattacagtgattggcgagcgtttacaacccagagcaaaagatgcgctg
ggctggggagcccttgctggttacgacggtgtttttgtgaccgctgcagatgcacctgca
ctgcatcattgtcgtcatgctggtgtgatggcagctactcctcgcgtgcgtctagagaca
cttgagcaggcgaatattcagcttgatgcgctgattggtagtggtcttgatccaggcgaa
cacgttccagataaagcgctctttccaactccccggctgagaattgcaactgaaggagct
ttaggcggtcagctatggcctgggggacgctatcaggctgtttcactgaagtctccagtc
gtggatgcttatggctgtggcgatagctttgccgctggggtaactgcaggtttggctgct
ggttggactgatgaacaggcgatcagcctaggggctcactgcggtgcaagctgtgcaact
cattttgggccttactccagtgatgagtga

DBGET integrated database retrieval system