KEGG   Prochlorococcus marinus MIT 9313: PMT1071Help
Entry
PMT1071           CDS       T00143                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMT1071 (malQ)
Enzymes [BR:pmt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PMT1071 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1156354..1157919)
Genome map
AA seq 521 aa AA seqDB search
MVEGSSALVRTTGVLLHPTALPVSPVCGSFGAPSRAWLQSLARHDIGVWQLLPLAPPDAT
GSPYSSPSSFALNPWLLDADDLVDEDFLSASVLRELPGTVPIQEPCASVDFALADLRSQR
LGIALREAWLEQARDQHLAFESWCGKQFWLEDHVLFMELRRQHQGLPWWEWPEGLAAHQR
SALNAWKGHHQEALLEHRLLQWQLDRQWQALRHLAGELGVLLFGDLPFYVARDSADVWSH
QGLFSILQGGELEIQSGVPPDYFSSTGQLWGTPVYRWWRHRLSGFHWWRSRFVRQWQQVD
LLRLDHFRALASYWAVPGSDSTAEHGEWRSSPGAALLKRLRRDAGGSLPLIAEDLGVITP
DVEELRDQFGLPGMKILQFAFDGNPSNPYLPENIQGHHWVVYTGTHDNPTTLGWWQQLDL
DARERVADRLKGAVHAPGWQLLELGLATEACLVMTPVQDLLHLDDAARFNTPGTVEGNWC
WRLSCFDSALDGALSGYGERGAVWGRSLESAAGLLTASASR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggttgagggcagttcagcgttagtccgcacgaccggggtgttacttcatcccacagca
ctgcctgtcagtccagtttgcggcagtttcggtgccccttcaagggcttggttgcaatca
cttgctcgccatgacattggtgtgtggcagttgttgcctttggctcctcctgatgcgaca
gggtctccctacagctccccttcaagctttgctctaaacccttggttgcttgatgccgat
gatcttgttgatgaggatttcctgtctgcatccgttctgcgtgagttgccaggaacagtt
cctatccaggagccttgcgcctcggttgattttgctttggctgaccttcgcagtcagcga
cttggcattgccttaagggaggcttggcttgagcaggctagagatcagcatcttgccttt
gagagttggtgtggcaagcagttctggcttgaggaccatgttttatttatggagctccgt
cgtcagcatcaaggccttccttggtgggaatggccggaaggcttggcagctcatcaacgt
agtgccctcaatgcctggaaaggtcatcatcaggaggctctgcttgaacatcgtttgctg
caatggcagcttgatcggcagtggcaagcactgagacatctagcaggcgagcttggcgtt
ttgttgtttggtgatctgcctttctatgttgcgcgcgatagcgctgacgtctggagtcat
cagggcctgttttcgattcttcaaggcggggagcttgagatccaaagtggtgttccccct
gattatttctccagtacaggacaactctggggcacgcctgtttatcgctggtggcggcat
cgcttgagtggattccattggtggcgtagccgctttgtgcgtcaatggcaacaggtggat
cttttacgcctcgaccatttcagggcgcttgcgtcttattgggcagttcctggatccgat
tcgacagcggagcacggggagtggcggtcttctccaggggcagctttattgaagaggcta
aggcgtgatgctggtggcagcttgccactgattgcagaagatctgggagtgattactcct
gatgtggaagagctacgagaccaatttggtttgcctggaatgaaaattctccagtttgct
tttgatggcaatcccagtaatccttatctacctgaaaatattcagggtcatcactgggtg
gtttatacaggcactcacgacaatccaacgacgctgggttggtggcagcagcttgatctc
gacgcccgtgagcgggtcgcagatcgattgaagggtgcagttcatgcccctggttggcag
ttgttggagctaggcctagcgacagaggcgtgtttagtgatgaccccagtgcaggatttg
cttcatttagatgatgcagctcgtttcaacacccctggcactgtcgaggggaattggtgt
tggcggttgtcttgctttgattcagctcttgatggggctctgagcggctatggtgagaga
ggagctgtctggggacgttcgcttgaatcggcagccggtttgctgacggcatctgcgagt
cggtaa

DBGET integrated database retrieval system