KEGG   Prochlorococcus marinus MIT 9313: PMT1077Help
Entry
PMT1077           CDS       T00143                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMT1077 (recR)
DNA repair and recombination proteins [BR:pmt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PMT1077 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1163056..1163625)
Genome map
AA seq 189 aa AA seqDB search
MIDQFERLPGIGPRTAQRLALHLLRQPEDQIRAFADALLAARSQVGQCQTCFHLSAEPLC
DICRDGKRCDQLLCVVADSRDLLALERTREYKGRYHVLGGLISPMDGIGPDMLQIPSLIQ
RVDRDGISEVILALTPSVEGDTTSLYLARLLKPFTQVSRIAYGLPVGSELEYADEVTLTR
ALEGRRAMQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaccagttcgagcgtctgcctgggattgggccacgaacggcccagagacttgcc
ctgcatctgttgagacaaccagaagatcaaatccgcgcttttgctgatgcactcctcgcg
gcccgttctcaagtgggtcaatgtcagacctgttttcatctcagcgcggagcctctttgc
gacatttgccgtgatggcaagcgatgcgatcaattgctttgtgtggtggctgattcccga
gatctgttagctctcgaaagaaccagggaatataagggccgttaccacgttctcggcgga
ctgatctcaccaatggatggtatcgggccggacatgctgcagatcccaagcttgattcaa
cgcgttgatcgtgatggcattagcgaggtcattctcgctctcactcccagtgtggaaggt
gacaccactagcctttatctggcacggttattaaagccgtttactcaagtgagtcgaatc
gcctacggccttcctgttggtagtgagttggagtatgccgacgaagttaccctgactcgt
gcgcttgaaggtcgtcgagctatgcaataa

DBGET integrated database retrieval system