KEGG   Prochlorococcus marinus MIT 9313: PMT1085Help
Entry
PMT1085           CDS       T00143                                 

Gene name
recD
Definition
UvrD/REP helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1171414..1173144)
Genome map
AA seq 576 aa AA seqDB search
MTRSDSSTWPSGFPRALHQTLLRRLPPKASSIHLEDLVNALMDALARGELQLNLTAMSPP
QELKAMGWPEAHCQALLASGWLEGAASPMVLNGNQLSWRRWHGDMDAVIKELINRSNVVQ
PTSICTTPSHHPALLDELNPEQQAAVEAIDNHGVLLLSGGPGTGKTSTIVQMLARAVTLR
PGLKIGLAAPTGKAARRLEEAVRKGLETIPPPQRQALTSLPCSTLHRWLQARPGGFGRHQ
QHPLMLDLLVIDEMSMVELALMQALLNALPVDSQLVMIGDPDQLPPVGSGAVWHQLQQAD
IRQQFNHGAIHLHQLYRNRGSLATLSRVLCDQGLSAFWQQLSLLSKSANVEQHQYNLSSM
PRFLVQHLQEHSRTLQRLTAELMLELPDDAYTSTMINTNFAVAAESLLDSLERLMVLCPK
RRGFWGVDHVHRALLGQSLEAGVMRWPLGTPVMCCENQAELGLANGDVGLVVGQGDNLRI
LFRVISEQGGLTTRFIHPARLSMVEPALALTVHKSQGSEADHVILLWPEITAVSATSTDG
CESASRFERKLLYTAITRARKRVDLVTAMPSARSDG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcagcgattcatccacttggccatcaggttttcccagagcactgcatcaaacg
ttgttgaggcgtctcccgcccaaggcttcatcaattcatctcgaggacttggtcaacgcc
ttgatggatgcattagcccgcggtgagctgcagctgaatctcactgcaatgtctccccct
caagaactcaaagcaatgggatggcctgaggctcattgtcaggccctgctggctagtggc
tggctggaaggcgcggcgtctccgatggttttaaacggcaatcaattgagttggcgtcgt
tggcatggtgacatggacgctgtgatcaaggagttgatcaacaggtcaaatgttgttcaa
ccgacttcaatctgcaccacaccatcccatcatcctgctttgttggatgaacttaaccct
gaacagcaggctgccgtagaagccatcgataaccatggcgtgttgttgttgagtggcggt
ccgggtacgggcaaaaccagcaccatcgtgcaaatgttggcgcgggcagtcacgttgaga
ccaggcctgaagattggtcttgctgctcccacaggcaaagcagcaagacgcctagaggag
gctgttcgcaaggggcttgagacaatccctcccccccagcggcaggcattgaccagcctg
ccttgtagcacccttcaccgttggcttcaggccaggcctggtgggtttggtaggcatcaa
caacaccccctaatgcttgatctcctcgttattgatgagatgtcgatggtggagcttgcc
ctgatgcaggcgttattaaacgctcttcctgttgatagtcagcttgtaatgattggtgat
cccgatcagttgcctccagttggtagtggagcggtttggcatcaactccaacaggctgat
atccgccaacagttcaatcatggtgccattcacctgcatcagctctatcgcaaccgcggt
tcactagcaacgttgagcagagttctgtgtgatcagggcctgtctgctttttggcaacaa
ctttctcttctgtcgaaatcagcgaacgttgagcagcatcaatacaacctcagcagtatg
ccaaggtttttagttcagcacttgcaggagcacagcagaacactgcaacgactcactgcc
gaactgatgctcgagctgccagatgatgcttatacctcaaccatgatcaataccaatttt
gctgttgcagctgagtctttgctggattctctcgagcggttgatggtgctttgtccgaaa
cgtcgtggtttttggggagtcgatcatgtgcatcgcgcattgttgggtcaaagccttgag
gctggagtaatgcgctggccgttgggaacgccggtgatgtgttgcgagaaccaagcggaa
ctggggctagcaaacggtgacgttggcttggtggttggtcaaggagacaatctgcgcatc
ctgtttcgcgtgatctctgagcagggaggactgaccacacgcttcatccacccggcccga
ttgagcatggtggagccagctttggctcttacggttcataagtctcaggggagtgaggct
gaccatgtcattcttctctggccggaaatcacagctgtatcggctaccagcactgatggt
tgtgagagcgcttctcgcttcgagaggaaacttctctacactgctatcacgcgcgcgcga
aagcgagtggatctcgttactgcaatgccatctgctcgtagtgacggctga

DBGET integrated database retrieval system