KEGG   Prochlorococcus marinus MIT 9313: PMT1135Help
Entry
PMT1135           CDS       T00143                                 

Gene name
chlI
Definition
protoporphyrin IX magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT1135 (chlI)
Enzymes [BR:pmt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT1135 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1226665..1227756
Genome map
AA seq 363 aa AA seqDB search
MSSTRKRRVFPFTSVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTAIRALADLLPG
IDVVAGDPYNSSPTDPDLQSSDVRQRIEHGESLATEERQVPMVDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVRDPDLRVQVVDQRTAFDSDPDTFATS
VQANQDALQQRVIEAQQRLEQVSLDNDLRLRISAVCGELDVDGLRGDIVTNRAARALAAF
AGRTEVSEEDVARVISCSLRHRLRKDPLEQIDSGDRVVKIFCKVFERSENSDQADFELTT
QAG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaacccgcaagcgcagggtctttccctttacctccgtgattggccaggaagag
atgaaactggctctgctgctcaacgtgatcgacccgcgaatcggcggagtcatgatcatg
ggagatcgaggcacgggcaagtccaccgcgatccgagccctagcagatctccttccaggg
attgatgtcgtcgctggcgacccttacaacagctcacccactgatccggatctacagagc
agtgacgtgcgccaacgcattgaacatggtgaaagccttgccactgaggagcggcaggtg
ccaatggtggatttgcctctcggtgccactgaagatcgtctttgcggcaccatcgacatc
gagaaggccctcagcgaaggagttcgtgcattcgagccaggcctgctggccaaggccaac
cgcggcttgctctacgtcgatgaagtcaatctgcttgacgaccatcttgtcgatgtgctg
ctggattcagcggcatcaggatggaacacggtggaacgtgaaggggtatcagtgcgacac
cctgcccgattcgtactgatcggctccggcaaccccgaggagggcgagctacgcccccaa
ctccttgatcgctttggcatgagtgttgaggtgcgcactgtccgcgatccagatctacgg
gtgcaggtggttgatcagcgcaccgcctttgatagcgatcccgatacctttgctacatcg
gtgcaagccaaccaagacgccttacaacaacgcgttattgaggcccagcaacgtcttgaa
caggtgagcctcgacaacgatttgcgcctacgaatctcggctgtctgtggcgaactagat
gtagatggactacgtggcgatatcgtcacaaaccgtgccgccagggctctagcagccttt
gcaggacgaacagaggtttcggaagaagatgtggcacgcgtgatctcttgctctctacgc
catcgattgcgaaaagaccccctcgagcagattgattcaggggatcgggtcgtcaaaatt
ttctgcaaagtattcgaacgcagcgagaacagcgatcaggctgacttcgagctaacaact
caagcaggctga

DBGET integrated database retrieval system