KEGG   Prochlorococcus marinus MIT 9313: PMT1378Help
Entry
PMT1378           CDS       T00143                                 

Definition
3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1463341..1464258)
Genome map
AA seq 305 aa AA seqDB search
MMPNAPVLPDGVNLEILLQHLRRLSWGAADILLAYARGEQPPHGFSKALSVEDGGEGPVS
AADLAVNRWLLDGLEANFPLADWTLLSEETAKEQLTAGEPLAAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVRGQRPVLGVVLLPEAEELWFGVIGSGAWCEDRRGKRSPVRFSQRQAVC
ELMLVASRNHRDNRLEQLLESLALGGSKAVGSVGCKVTTILRGETDLYVSLSGRSAPKDW
DMAAPEAVLMAAGGCFTHADGRQLAYNSGDVRQAGCLIASHGLAHAQLCEAAARAMKEID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgaacgcacctgttctgcctgatggtgtgaacctggagattttgttgcagcac
ttgaggcgattgagctggggtgctgcagacatcctgctggcctatgcccggggagaacag
ccaccgcatggattttctaaggctctgagtgttgaggatggtggtgaggggcctgtttct
gccgctgaccttgcggtgaatcgctggcttctggatggcttagaagcgaatttccccttg
gcagattggactctattgagtgaggagacagcaaaggagcaactcactgcaggcgaaccc
ttagcggcggaatggttgtggatccttgatcccttggatggcacaaaggatttcttgcag
ggcacaggtgaatacgccgtgcatctcgctttggtgcgtggtcaacgcccagtgcttgga
gtggtactcctgccagaagccgaggagctttggttcggtgtgatcggttctggggcttgg
tgcgaagaccggcggggaaaacgttcgccggtgcgttttagtcagcgccaggctgtttgt
gagttgatgctggtagcgagtcgcaaccaccgcgacaacaggcttgaacagctgctagag
agtcttgctcttggtggtagcaaggctgtgggcagtgtgggttgcaaggtgaccacgatt
ttgcgcggagaaacagatttgtatgtctctctttcaggccgtagtgctccaaaagattgg
gatatggcggctccagaggcggtgctgatggcggcagggggatgtttcactcatgctgat
ggacgccagcttgcttataacagcggtgatgtacgtcaggctggatgtttaatcgccagc
catgggctcgcccacgcccagctttgtgaagcagcggcgcgggctatgaaagagatcgac
ccaggctttcaggtttga

DBGET integrated database retrieval system