KEGG   Prochlorococcus marinus MIT 9313: PMT1507Help
Entry
PMT1507           CDS       T00143                                 

Gene name
rpoB
Definition
DNA-directed RNA polymerase subunit beta (EC:2.7.7.6)
Orthology
K03043  
DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pmt00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:pmt03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1593258..1596551)
Genome map
AA seq 1097 aa AA seqDB search
MSSSAIQVAKTATYLPDLVEVQRASFKWFLDEGLIEELDSFSPITDYTGKLELHFVGNEY
RLKRPRHDVEEAKRRDATFASQMYVTCRLVNKETGEIKEQEVFIGELPLMTERGTFIING
AERVIVNQIVRSPGVYFKDEQDKNGRRTYNASVIPNRGAWLKFETDKNDLLHVRVDKTRK
INAHVLMRAMGLSDNDVIDKLRHPEYYKKSIEAANEEGISSEDQALLELYKKLRPGEPPS
VSGGQQLLQTRFFDPKRYDLGRVGRYKINKKLRLTIPDTVRTLTHEDVLSTLDYLINLEL
DVGGASLDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIKERMTVGETDSLTPAQLVNP
KPLVAAVKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHY
GRLCPIETPEGPNAGLINSLATHARVNQYGFIETPFWKVENGRLIKEGDPIYLSADLEDE
CRVAPGDVATDADGQILAELIPVRYRQDFEKVPPEQVDYVQLSPVQVISVATSLIPFLEH
DDANRALMGSNMQRQAVPLLRPERPLVGTGLETQVARDSGMVPISRVNGMVTFVDATAII
VRDEDGVDHTHYLQKYQRSNQDTCLNQRPIVCQGDAVIVGQVLADGSACEGGEIALGQNV
LVAYMPWEGYNYEDAILVSERLVKDDLYTSVHIEKYEIEARQTKLGPEEITREIPNVAEE
SLGNLDEMGIIRIGAFVESGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRV
PSTERGRVVDVRIYTREQGDELPPGANMVARVYVAQRRKIQVGDKMAGRHGNKGIISRIL
PREDMPFLPDGTPVDIVLNPLGVPSRMNVGQVFECLMGWAAANLDCRVKVVPFDEMYGAE
KSQQTVEAYLKEAAKQPGKEWVYNPDNPGKLQLIDGRSGEPFDQPVTVGYAQILKLVHLV
DDKIHARSTGPYSLVTQQPLGGKAQQGGQRLGEMEVWALEAYGAAYTLQELLTVKSDDMQ
GRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVYTDEGKEVDLMQDVNPRRST
PSRPTYESLGVADYDED
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcgcgattcaggtcgccaagaccgccacctacctgcctgatctcgttgaa
gttcagcgggcgagcttcaagtggtttcttgatgagggcttgatcgaggagttggatagc
ttttctcccatcactgactacacaggcaagcttgaactccattttgttggcaatgaatac
cgattgaagcggcctcgccacgatgttgaagaggccaagcgccgtgatgcgactttcgct
tcacagatgtatgtgacctgtcgcttagtgaataaggaaacaggtgagattaaggagcag
gaggtgtttattggcgagcttcctctgatgactgagcgaggtacgttcattatcaatggt
gcagagagggttattgttaatcagattgtgcgcagcccaggggtatattttaaggatgaa
caggataagaatggacggcgaacatacaatgccagtgttatccctaaccgtggtgcctgg
ctaaagttcgaaacagataaaaacgaccttctgcatgtgcgtgttgataaaacacgcaaa
attaatgcccatgttttaatgcgggccatggggctatcagataacgatgtaatcgataag
cttcgtcaccccgagtattacaagaagtctattgaggctgcaaatgaggaaggaattagt
tcagaggatcaggctttgcttgagctttataaaaagcttcgtcctggtgagcctccttca
gtaagcggtggtcaacagcttctgcagacccgattttttgatcccaagcgttacgacctt
ggccgagttggccgttacaagattaataaaaagctgcgtctaacaatcccggatacggtg
cggaccctcacccatgaggatgtgctctcaacccttgattatctgatcaatttagaactc
gatgtgggtggtgccagccttgatgacattgatcacctgggcaatcgtcgagtgcgttca
gtgggtgaacttttgcagaaccaggtccgggttggtctcaatcgcctggagaggatcatt
aaagaacggatgacggtgggagagaccgattcgctcacgccagctcagttggtgaacccc
aagcctctcgttgcagctgttaaggagttcttcggttccagtcagctgagtcagttcatg
gatcagacgaatccattggctgagctcacccacaaacgtcgtatctcagctctggggcca
ggtggcctcactagggagcgtgctggcttcgcggtgcgtgatattcacccttcccattat
ggccgtctctgcccaattgagacaccggaaggcccgaatgcaggtttgatcaattcactg
gctacccacgctcgggtcaatcagtatggcttcattgagactcccttttggaaggttgag
aacggtcgcctgatcaaggagggagaccccatctatttatcagccgatcttgaggatgag
tgtcgtgtagctcctggtgatgtggccacggacgccgatggacagattctcgctgaatta
attccagtgcgttatcgccaggacttcgaaaaagttccacctgagcaagtggattatgtg
cagctctcgccggtgcaggtgatctctgtcgccacctccttgattcctttcctcgagcac
gatgacgccaatagggctctgatgggatcaaatatgcaacggcaggccgtaccactgttg
cggcctgagcggcctttggtggggacgggtctcgaaactcaggtggctcgtgattccggg
atggtgcccatctcccgcgtgaatggcatggtcacattcgtggatgccactgcgatcatc
gtccgggatgaggatggggttgatcacacccactacctgcagaagtatcagcgttcaaat
caggacacctgccttaatcagcgtccgattgtctgccagggtgatgcggtgatcgtgggt
caggttctcgcggatggttcggcttgtgaaggcggtgaaattgctctaggtcagaacgtt
ttggtcgcttatatgccttgggagggttacaactatgaggacgctattcttgtcagcgaa
cgactagttaaggacgacctctacacctcggtgcatatcgagaagtatgagatcgaggca
cgacagacaaagcttggccccgaagagatcaccagggagatacccaatgttgccgaggaa
agccttggcaatcttgatgaaatgggcatcattcgcatcggtgcttttgtcgagagtggc
gacattctggtgggcaaagtgacacctaaaggtgagtcagatcagcctccagaagagaag
cttttgcgtgccatttttggtgaaaaagcgcgcgatgtgcgtgataactctctacgcgtt
cccagcactgagcgaggacgagttgtggacgttcgtatttacactcgtgaacagggtgat
gagcttccccctggcgccaatatggtcgctcgagtgtatgtggctcagcgtcgcaagatc
caggttggcgacaagatggccggtcgccacggcaataaaggcatcatcagtcgcattctt
ccccgcgaagacatgccttttctgcccgatggcactccagttgacatcgttttgaatcct
ttgggcgtgcccagccggatgaatgtgggtcaggtgtttgagtgcttaatgggatgggca
gcagccaatctcgactgtcgggtcaaggtggtgccttttgatgaaatgtatggagctgaa
aagtcccagcagacagtggaggcttatctcaaggaagctgccaaacagccaggtaaggag
tgggtctacaaccctgacaatcctggcaagcttcaattgattgatgggcgttcgggtgaa
cctttcgaccagccggtgaccgttggctatgcacagattctgaagcttgttcatttggtt
gatgacaagatccatgctcgttcaacaggtccctattcactggtaacccagcaacctctt
ggcggtaaggctcaacaaggtggccaacgtttaggggagatggaggtgtgggctctggag
gcctatggcgccgcttacaccctgcaagagctgctgactgttaaatcagacgatatgcag
ggtcggaatgaagccctcaatgcaatcgtcaagggcaaacctatccccaggccggggaca
cccgagtctttcaaggtcttgatgcgtgagcttcagtctctagggctcgatatcgctgtt
tataccgatgaaggcaaagaagtggatctgatgcaggatgtgaatccccgccgtagtact
cctagtcgacccacttacgaatcccttggagtagcggattacgacgaagattaa

DBGET integrated database retrieval system