KEGG   Prochlorococcus marinus MIT 9313: PMT1507Help
Entry
PMT1507           CDS       T00143                                 

Gene name
rpoB
Definition
DNA-directed RNA polymerase subunit beta (EC:2.7.7.6)
Orthology
K03043  
DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMT1507 (rpoB)
   00240 Pyrimidine metabolism
    PMT1507 (rpoB)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    PMT1507 (rpoB)
Enzymes [BR:pmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     PMT1507 (rpoB)
Transcription machinery [BR:pmt03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     PMT1507 (rpoB)
DNA repair and recombination proteins [BR:pmt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      PMT1507 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1593258..1596551)
Genome map
AA seq 1097 aa AA seqDB search
MSSSAIQVAKTATYLPDLVEVQRASFKWFLDEGLIEELDSFSPITDYTGKLELHFVGNEY
RLKRPRHDVEEAKRRDATFASQMYVTCRLVNKETGEIKEQEVFIGELPLMTERGTFIING
AERVIVNQIVRSPGVYFKDEQDKNGRRTYNASVIPNRGAWLKFETDKNDLLHVRVDKTRK
INAHVLMRAMGLSDNDVIDKLRHPEYYKKSIEAANEEGISSEDQALLELYKKLRPGEPPS
VSGGQQLLQTRFFDPKRYDLGRVGRYKINKKLRLTIPDTVRTLTHEDVLSTLDYLINLEL
DVGGASLDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIKERMTVGETDSLTPAQLVNP
KPLVAAVKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHY
GRLCPIETPEGPNAGLINSLATHARVNQYGFIETPFWKVENGRLIKEGDPIYLSADLEDE
CRVAPGDVATDADGQILAELIPVRYRQDFEKVPPEQVDYVQLSPVQVISVATSLIPFLEH
DDANRALMGSNMQRQAVPLLRPERPLVGTGLETQVARDSGMVPISRVNGMVTFVDATAII
VRDEDGVDHTHYLQKYQRSNQDTCLNQRPIVCQGDAVIVGQVLADGSACEGGEIALGQNV
LVAYMPWEGYNYEDAILVSERLVKDDLYTSVHIEKYEIEARQTKLGPEEITREIPNVAEE
SLGNLDEMGIIRIGAFVESGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRV
PSTERGRVVDVRIYTREQGDELPPGANMVARVYVAQRRKIQVGDKMAGRHGNKGIISRIL
PREDMPFLPDGTPVDIVLNPLGVPSRMNVGQVFECLMGWAAANLDCRVKVVPFDEMYGAE
KSQQTVEAYLKEAAKQPGKEWVYNPDNPGKLQLIDGRSGEPFDQPVTVGYAQILKLVHLV
DDKIHARSTGPYSLVTQQPLGGKAQQGGQRLGEMEVWALEAYGAAYTLQELLTVKSDDMQ
GRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVYTDEGKEVDLMQDVNPRRST
PSRPTYESLGVADYDED
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcgcgattcaggtcgccaagaccgccacctacctgcctgatctcgttgaa
gttcagcgggcgagcttcaagtggtttcttgatgagggcttgatcgaggagttggatagc
ttttctcccatcactgactacacaggcaagcttgaactccattttgttggcaatgaatac
cgattgaagcggcctcgccacgatgttgaagaggccaagcgccgtgatgcgactttcgct
tcacagatgtatgtgacctgtcgcttagtgaataaggaaacaggtgagattaaggagcag
gaggtgtttattggcgagcttcctctgatgactgagcgaggtacgttcattatcaatggt
gcagagagggttattgttaatcagattgtgcgcagcccaggggtatattttaaggatgaa
caggataagaatggacggcgaacatacaatgccagtgttatccctaaccgtggtgcctgg
ctaaagttcgaaacagataaaaacgaccttctgcatgtgcgtgttgataaaacacgcaaa
attaatgcccatgttttaatgcgggccatggggctatcagataacgatgtaatcgataag
cttcgtcaccccgagtattacaagaagtctattgaggctgcaaatgaggaaggaattagt
tcagaggatcaggctttgcttgagctttataaaaagcttcgtcctggtgagcctccttca
gtaagcggtggtcaacagcttctgcagacccgattttttgatcccaagcgttacgacctt
ggccgagttggccgttacaagattaataaaaagctgcgtctaacaatcccggatacggtg
cggaccctcacccatgaggatgtgctctcaacccttgattatctgatcaatttagaactc
gatgtgggtggtgccagccttgatgacattgatcacctgggcaatcgtcgagtgcgttca
gtgggtgaacttttgcagaaccaggtccgggttggtctcaatcgcctggagaggatcatt
aaagaacggatgacggtgggagagaccgattcgctcacgccagctcagttggtgaacccc
aagcctctcgttgcagctgttaaggagttcttcggttccagtcagctgagtcagttcatg
gatcagacgaatccattggctgagctcacccacaaacgtcgtatctcagctctggggcca
ggtggcctcactagggagcgtgctggcttcgcggtgcgtgatattcacccttcccattat
ggccgtctctgcccaattgagacaccggaaggcccgaatgcaggtttgatcaattcactg
gctacccacgctcgggtcaatcagtatggcttcattgagactcccttttggaaggttgag
aacggtcgcctgatcaaggagggagaccccatctatttatcagccgatcttgaggatgag
tgtcgtgtagctcctggtgatgtggccacggacgccgatggacagattctcgctgaatta
attccagtgcgttatcgccaggacttcgaaaaagttccacctgagcaagtggattatgtg
cagctctcgccggtgcaggtgatctctgtcgccacctccttgattcctttcctcgagcac
gatgacgccaatagggctctgatgggatcaaatatgcaacggcaggccgtaccactgttg
cggcctgagcggcctttggtggggacgggtctcgaaactcaggtggctcgtgattccggg
atggtgcccatctcccgcgtgaatggcatggtcacattcgtggatgccactgcgatcatc
gtccgggatgaggatggggttgatcacacccactacctgcagaagtatcagcgttcaaat
caggacacctgccttaatcagcgtccgattgtctgccagggtgatgcggtgatcgtgggt
caggttctcgcggatggttcggcttgtgaaggcggtgaaattgctctaggtcagaacgtt
ttggtcgcttatatgccttgggagggttacaactatgaggacgctattcttgtcagcgaa
cgactagttaaggacgacctctacacctcggtgcatatcgagaagtatgagatcgaggca
cgacagacaaagcttggccccgaagagatcaccagggagatacccaatgttgccgaggaa
agccttggcaatcttgatgaaatgggcatcattcgcatcggtgcttttgtcgagagtggc
gacattctggtgggcaaagtgacacctaaaggtgagtcagatcagcctccagaagagaag
cttttgcgtgccatttttggtgaaaaagcgcgcgatgtgcgtgataactctctacgcgtt
cccagcactgagcgaggacgagttgtggacgttcgtatttacactcgtgaacagggtgat
gagcttccccctggcgccaatatggtcgctcgagtgtatgtggctcagcgtcgcaagatc
caggttggcgacaagatggccggtcgccacggcaataaaggcatcatcagtcgcattctt
ccccgcgaagacatgccttttctgcccgatggcactccagttgacatcgttttgaatcct
ttgggcgtgcccagccggatgaatgtgggtcaggtgtttgagtgcttaatgggatgggca
gcagccaatctcgactgtcgggtcaaggtggtgccttttgatgaaatgtatggagctgaa
aagtcccagcagacagtggaggcttatctcaaggaagctgccaaacagccaggtaaggag
tgggtctacaaccctgacaatcctggcaagcttcaattgattgatgggcgttcgggtgaa
cctttcgaccagccggtgaccgttggctatgcacagattctgaagcttgttcatttggtt
gatgacaagatccatgctcgttcaacaggtccctattcactggtaacccagcaacctctt
ggcggtaaggctcaacaaggtggccaacgtttaggggagatggaggtgtgggctctggag
gcctatggcgccgcttacaccctgcaagagctgctgactgttaaatcagacgatatgcag
ggtcggaatgaagccctcaatgcaatcgtcaagggcaaacctatccccaggccggggaca
cccgagtctttcaaggtcttgatgcgtgagcttcagtctctagggctcgatatcgctgtt
tataccgatgaaggcaaagaagtggatctgatgcaggatgtgaatccccgccgtagtact
cctagtcgacccacttacgaatcccttggagtagcggattacgacgaagattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system