KEGG   Prochlorococcus marinus MIT 9313: PMT1510Help
Entry
PMT1510           CDS       T00143                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1598149..1599477
Genome map
AA seq 442 aa AA seqDB search
MTQSGQAESETPSTLIHCVRDRQQAKRELERLANRSTGNSQKQAMATVEDILDTVRSQGD
QALITLTERFDGFRPEPLTVAPEELEDAWRKTPQKLQSALELAYRRIQDFHQHQRPNDLM
VQGIHGEQLGRRWRPVQKAGIYIPGGRAAYPSTVLMNAVPAQVAGVEQLVMTSPAGRDGQ
INRTVLAAAHLAGIREVLRLGGAQAIAALAFGTETVPKVDVISGPGNLYVTLAKKAVYGQ
VGIDSLAGPSEVLVIADQSARVEQVAADLLAQSEHDPLAAAVLLTTEASLAEQLPSHLEA
QLKGHPREQICRASLSNWGLVVICESLERCAQLSDHFAPEHLELLVEHPHAIADCIKNAG
AIFIGPWTPEAVGDYLAGPNHTLPTCGTARFSGALSVETFLRHTSLIEFNRSALEATANA
VRELASSEGLHSHAESVRIRFE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgacacaaagcggccaggccgagtcagagactccctcaaccctgattcattgtgttcgg
gatcggcaacaagccaagcgtgaactagagcggctggccaaccgctctaccggcaattct
caaaagcaagccatggcgacggtggaggacatcctcgacaccgttcgcagccaaggggac
caagccctgatcaccttgaccgagcgctttgacggttttcgtccagagccattaaccgta
gctccagaagagttggaagacgcctggcgaaaaactccccaaaaacttcaatctgctctg
gaactggcctatcgccgtatccaggatttccatcagcatcagcgaccgaatgacctgatg
gtgcaaggcatccatggcgaacaattgggccgccgctggcgccctgtacaaaaagccggg
atctacatcccaggaggccgagctgcctatccgagcacagtgctaatgaatgcagtccca
gcccaagtagccggtgtggagcagctggtgatgacttcacccgcgggaagggatggtcag
atcaacagaaccgttctagccgccgcacacctagcaggcattcgtgaggtcttgcgtctc
ggtggtgcccaagccatcgcagccctggcctttggcactgaaaccgtgccaaaggtcgat
gtgatcagcggacccggcaatctctacgtcacccttgcgaaaaaggccgtctacgggcaa
gtgggcattgattcgctcgccggcccaagtgaggttttagtcatcgccgaccagagtgct
cgtgttgagcaggtggccgccgacctactggcccaatcagaacacgatccacttgctgct
gcagtactactcaccaccgaagcaagcctcgccgaacagctcccatcccatttggaggct
cagcttaaggggcaccctcgcgagcagatctgccgagcctctttaagcaactgggggctg
gtcgtgatctgtgaaagcctggaaagatgcgctcaactcagcgatcacttcgcacctgag
cacttggagttattggtcgagcacccgcacgccattgccgactgcatcaaaaatgccggc
gccatcttcatcggcccctggacccctgaagcggtaggcgactatctagccggaccaaac
cacacactaccgacatgcggaacggcccgcttcagcggcgccctgagcgtggaaacattt
ctgcggcacacctctctaatcgaattcaatcgatctgcccttgaggccactgctaacgcc
gtaagggaattggccagcagcgaaggcttgcacagccatgctgaatccgtgcgtatccgc
ttcgaataa

DBGET integrated database retrieval system