KEGG   Prochlorococcus marinus MIT 9313: PMT1547Help
Entry
PMT1547           CDS       T00143                                 

Gene name
T6C23.6
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1639197..1640261)
Genome map
AA seq 354 aa AA seqDB search
MASDGSTLRRDLRSRDCYAVLMDLTYRPRRLRRTPALRSMVREHSLTAADFIYPLFVHEG
AGVEPIGAMPGTNRWSLDRLMAEVQRAWGLGIRCVVLFPKVAEGLKTEDGAECFNEHGLI
PRAITQLKHELPEMTVMTDVALDPYSCDGHDGIVSTEGVVLNDETIEQLCRQAVVQARAG
ADMIGPSDMMDGRVGAIREALDDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRVAGGK
PIPKDKSTYQMDPANAREAITEAQLDEQEGADILMVKPGLAYLDIIHRLSEESELPIAAY
NVSGEYSMVKAAAERGWLDERAVVLETLLSFKRAGADLILTYHACDAAAWLRQG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggcttcagatggctccactctgaggcgagacttacgctcacgagattgttatgcggtt
ttgatggatctcacttatcgccctcgtcggctgcgtcgtactcctgccctgcgttccatg
gtgcgggagcacagcctcactgctgctgactttatctatcccttgtttgtccatgaggga
gctggtgttgagccgatcggtgccatgccaggaaccaatcgctggagcctcgatcgctta
atggcagaagttcaacgggcctgggggctgggcattcgttgtgtggtgcttttcccgaaa
gttgctgagggcctcaaaactgaagatggggcggaatgtttcaatgagcatgggttgatt
ccgcgggccatcacgcagctcaagcatgagctgccggaaatgacagtgatgaccgatgtg
gctttggatccctattcctgtgatggtcatgacggcatcgttagcaccgagggtgtggtg
cttaacgacgagacgattgaacaactctgtcgtcaggcggtggttcaggctcgtgctggt
gctgacatgattggacccagcgacatgatggatggccgcgtcggcgccatccgtgaagct
cttgacgacgagggttttgagcatgtggggatcatcagctatacagcgaaatactcttcg
gcgtactacggcccgtttcgcgaggcgcttgattcagccccgcgcgtggctggtggcaag
ccaatccctaaagacaagagtacttatcaaatggatccagccaatgctcgtgaggccatt
actgaggctcaactcgatgagcaggaaggtgcagacattctcatggtgaagcctggcctg
gcctatctcgacatcattcatcgtttaagcgaagaatcggagttacccatcgctgcttac
aacgtgagtggcgagtattcgatggtgaaggctgctgcggaaaggggttggcttgatgag
cgggcggtggttctagaaaccttgttgagtttcaagcgagctggtgccgatttgatcctc
acctaccacgcttgtgatgcagccgcttggttacggcagggatga

DBGET integrated database retrieval system