KEGG   Prochlorococcus marinus MIT 9313: PMT1887Help
Entry
PMT1887           CDS       T00143                                 

Gene name
chlD
Definition
protoporphyrin IX magnesium chelatase subunit ChlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT1887 (chlD)
Enzymes [BR:pmt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT1887 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1991152..1993296
Genome map
AA seq 714 aa AA seqDB search
MVASGSAATANTRSRDRAGQDMATRAFPLAAITGHGTLKLSLLLAAVDPELGGVVIAGGR
GTGKSVLARGLHALLPPIDVLDLEALSKDQQTSQIHRPIGLNLDPKLPEEWDEASQRLIT
KQGATDEENSKEPLPSRVIPAPFVQVPIGITEDRLVGAVDVTASLTSGTPVFQPGLLAEA
HRGVLYLDELNLLDDGIVNLMLAAVGAGENRVEREGLSLSHPCRPLLIATYNPEEGAMRD
HLLDRFAIALSADQLISNEQRVEITEAVLAHGQCSVSFAAKWAQETEALATQLLLARQWL
PDVQISHAQIEYLVNEAIRGGVEGHRSELYAVRVARAHAALSGRDQVEADDLQVAVRLVI
APRALQLPPQEEQMEPPPPEQQQAPPPPDQSQEDTSEEDEDEEDDEDTPEEQTSPPVPEE
FMLDPEAIAIDPDLLLFSAAKSKSGNSGNRSAVLSDSRGRYVRPIIPRGPVRRIAVDATL
RAAAPYQKARRSRQPDRTVIVEEGDLRAKLLQRKAGSLVIFLVDASGSMALNRMQGAKGA
VIRLLTEAYENRDEVSLIPFRGEQAEVLLPPTKSITAAKRRLEVMPCGGGSPLAHGLTQA
ARVGANALSKGDLAQVVVVAITDGRGNVPLGTSLGQPQLEGEDPPDLKQELLDVASRYRS
LGIKLLVIDTERKFIGSGMGKDLAEAAAGKYVQLPKATDQAIAAIAMEAIDQVK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaagcggatcggccgcaactgccaacacaaggtccagagatcgagcaggccag
gacatggccactcgtgcttttcctcttgccgcaattacaggccatggaacgctcaagctt
tcactgctcctagcagcggttgatccagaactgggtggggtggtgatcgccggcggccgc
ggcactggcaaatcggtcttggcacggggactgcatgcactgctaccgccaatcgatgtg
ctcgatctggaagcccttagcaaagatcagcagacttcacaaattcatcgccccattggt
ctcaatctggatccaaagctccctgaggaatgggacgaagccagccaacgcctgatcacg
aaacagggcgccaccgatgaggagaactcaaaggagccactgccgagccgtgtgatccca
gcaccctttgtgcaagttccaattggcattactgaagacagacttgttggcgctgtagac
gtcacggcctccctaaccagtggaacccctgtcttccaacctggactactagcagaagcc
catcggggagtgctctatctcgatgagctcaatctgttggatgacggtatcgtcaacctc
atgctggcggcagtgggagccggcgaaaaccgagtagagcgagaaggcctcagcctcagc
catccctgccgtccactactgattgctacttacaaccctgaagaaggggcaatgcgcgac
cacctattggaccgtttcgccatcgctctctccgccgaccagctgatcagcaacgagcaa
cgtgttgagatcaccgaggcagtactggcccatggccaatgcagtgtcagcttcgctgca
aagtgggcccaggagaccgaagcactagcaactcagctgctactggctcgtcaatggctg
cccgatgtacaaatcagccacgcacagatcgaatatctggtcaatgaagccattcgtgga
ggcgtggaagggcatcgctctgagctttatgcagtacgcgtggcacgggcccacgcggct
ctcagcggccgagaccaggttgaagcagacgacctccaagtcgccgtgcggctggtgatt
gcaccgcgtgcattgcaattgccgcctcaagaagagcaaatggagccccccccgccagag
caacagcaagcaccgccaccaccagatcaatcgcaagaagacacttctgaagaagatgag
gatgaagaggatgacgaagacacccctgaagagcagacatcaccaccggttccagaagaa
ttcatgcttgatccagaagcaattgcaatcgatccagaccttttgctgttttctgcagcc
aagtcaaaaagtggaaacagtgggaaccgttcggcagtcctcagtgacagccgtggccgc
tacgtcaggcccatcatccctcgtggccctgttcgacgtatcgccgtcgacgcgacatta
agagctgcggccccatatcaaaaagctcggcgatccagacagccggatcgcacagtgatt
gtcgaagaaggagatctgagagccaagttgctgcaacgcaaggctggttcactcgtcatt
ttccttgttgatgcaagcggttcgatggctctaaatcgcatgcagggcgccaagggagca
gtcattcgcttactcaccgaggcctatgagaaccgagatgaggtttcactcatcccattc
cgaggagaacaagcggaggttttactgcctccaaccaaatcgattactgcagcaaaaaga
aggctagaagtgatgccctgcggcggcggctctcctctcgcccatggtcttacccaggct
gctcgtgtgggtgctaacgcattgtctaaaggagatctcgcccaagttgtcgttgttgcc
atcacggatggacgcggcaatgtgcctttagggacctcactaggtcagccacaacttgaa
ggagaagatccaccggatctaaagcaggaattacttgatgtcgcgagccgctaccgcagt
ctggggatcaaattgctagtcatcgataccgagcgtaagttcatcggcagtggtatgggc
aaggacctagcagaagctgccgccggcaaatacgtccaactgccaaaggcaactgatcaa
gcgattgccgccatcgcaatggaagcaatagaccaggttaaataa

DBGET integrated database retrieval system