KEGG   Prochlorococcus marinus MIT 9313: PMT1995Help
Entry
PMT1995           CDS       T00143                                 

Gene name
plsX
Definition
glycerol-3-phosphate acyltransferase PlsX
Orthology
K03621  
glycerol-3-phosphate acyltransferase PlsX [EC:2.3.1.15]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pmt00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pmt00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2109174..2110520
Genome map
AA seq 448 aa AA seqDB search
MPPKDSDSSTASGPRSKTTRPRAIRRLVIWYRRNAAVTSLVGSATNSASAAGNVAGTVVS
SAGSVVSNAGSMAGSMLQPLVFDPLRRLQSSENNPEAEDIKNSDRLWVAVDGMGGDEAPG
PILDGCLKAIQRLPLRIKFVGETEKVLGAVQAMGLTELFNQATAAGHLELVASGPSVGMD
EEATVVRRKRDASINLTMDLVKKGEALAMYSAGNSGAMMASAIFRLGRLAGIDRPAIGAL
FPTKDPTQPVLVLDVGANMDCKPIYLHQFALLGNIYSRDVLQVARPRIGLLNIGEEECKG
NDLAIRTHELLSEEHRLQFAGNCEGRDVLSGAFDVVVCDGFTGNVLLKFLESVGSVLLDV
LRAELPRGRRGKVGSAFLRSNLKRIKKRLDHAEHGGALLLGVNGICVIGHGSSKALSVVS
ALRLAHSAASHGVMDDLAELQKAPVESA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgcccccgaaggactctgattcctccacggcctccgggccccggagcaagaccacccgc
cccagagccattaggcgtctggtgatctggtatcgccgcaatgctgccgttaccagcctg
gtaggaagtgccacaaactcagcttccgccgctggaaacgtagccggaacagttgtttcc
agtgctggatccgtggtgtcgaatgctggatcaatggcaggaagcatgcttcagccactc
gtttttgatcccctgcggcgactacaaagcagcgaaaacaacccagaagcggaggacatc
aaaaatagcgatcggctctgggttgccgtcgatggcatgggtggagacgaggctcctggc
cccattcttgatggctgtctaaaagcgattcaaagacttcccctccgcatcaagttcgtc
ggagagaccgaaaaagtgttaggcgctgtccaagccatgggtctcaccgaactcttcaac
caagccacagccgctggtcatctggagcttgtcgcaagcggtccctctgtgggcatggat
gaagaggccactgtggtgcgccgcaaacgcgacgccagcatcaacctgaccatggacctg
gtcaaaaagggcgaagctctagcaatgtattcagctggaaattccggagccatgatggcc
tcagccatcttccgactggggcgtctagcagggatagaccgtccggccatcggtgctcta
ttcccaacaaaagatccaacacaaccagtgctagtactggatgtgggcgccaacatggat
tgcaagcccatctacctccaccaatttgccctacttggcaatatctattcccgcgacgtt
ctccaggtggctcgcccacgcatcgggcttctgaatattggcgaagaggagtgcaagggc
aacgatctagccattcgcactcatgagctactcagcgaagagcatcggcttcaattcgcg
ggcaactgcgaaggtcgtgatgttctttcaggggctttcgacgtggtggtatgtgatggc
ttcaccggcaatgtgctcctcaaattcctggagtctgtcggcagcgtgctgcttgatgta
ttacgagccgaactgccacgaggcagacgcggcaaggtgggttctgcgttcctacgcagc
aacctcaaacgaattaagaaacgcctcgaccatgcagaacatggtggggcactattgctg
ggtgtgaatggcatctgtgtgatcggccatggcagcagcaaggcgctatcggtggtcagt
gcactacgactagcccactccgcagcgagccatggtgtcatggacgatttagccgaactg
caaaaggcacctgttgaaagcgcctaa

DBGET integrated database retrieval system