KEGG   Prochlorococcus marinus MIT 9313: PMT2027Help
Entry
PMT2027           CDS       T00143                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT2027 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT2027 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMT2027 (trpB)
Enzymes [BR:pmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMT2027 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2138965..2140275)
Genome map
AA seq 436 aa AA seqDB search
MLLGVILSIPRLVLFLPGVPVTSTLPSQPKDADLAVSARPSAQGRFGRYGGQYVPETLMP
ALAELEQAAALAWKDPAFTAELDRLLRSYVGRATPLYEAERLTAHYCRSDGGPRIWLKRE
DLNHTGAHKINNALGQALLALRMGKKRIIAETGAGQHGVATATVCARFGLECVVYMGAED
MRRQALNVFRMRLLGATVQPVTAGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYP
MLVRDFHAVIGQEARQQCAEAFGRLPDVLLACVGGGSNAMGLFHPFVQDRSVRMIGVEAA
GDGVETGRHAATITEGRVGVLHGAMSLLLQDDEGQVQEAHSISAGLDYPGVGPEHSYLCE
IGRAEYAAVSDQQALDALRLVSELEGIIPALETAHAFAWLETLCPTLAAGTEVVINCSGR
GDKDVNTVAEKLGNQL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcttggggtgattctttcgattcctaggctggtgttgttcttgcctggcgtaccg
gtgaccagcactctgccctctcagcccaaagatgcggacctcgctgtgagtgcgcgacct
tctgcccaggggcgtttcggcagatatgggggccagtacgtgcccgaaaccttgatgcct
gccttggctgaactggagcaagcagctgcgctggcatggaaagatcctgccttcactgct
gagttggatcggttgctgcgtagctatgtgggtcgggcgacgccgctttatgaggctgag
cgcctcacagctcattactgccgttcagacggaggacccaggatctggcttaagcgtgag
gatctcaatcacacaggcgcccacaaaatcaataacgctttgggtcaggctctgttggcg
ttacgcatgggtaaaaagcggatcattgccgaaacaggtgcgggtcaacacggtgtggcc
acggccacggtgtgtgcccgttttggtcttgagtgtgtcgtctacatgggggctgaggac
atgcgccgtcaggcgttgaatgtgttccgcatgcgtctgctgggagccacagtgcagcct
gtcaccgcaggcacggccacgctgaaggacgcgacgagtgaggcgattcgtgattgggtc
accaatgtggaaaccacccattacatccttggttcggtggctggtccccatccctatccg
atgcttgttcgcgactttcatgccgtgatcggtcaggaggccaggcagcagtgtgctgag
gctttcggtcgcttgcctgatgttcttttggcgtgcgttggtggtgggtccaatgccatg
ggtttgtttcatcccttcgtgcaggaccgctctgtgcgcatgattggagtggaagctgct
ggtgatggtgttgaaactggtcgtcatgcggcaacaatcaccgaaggtcgagtaggcgtc
ttgcatggagcgatgagtttgttgcttcaggatgatgaaggtcaggtgcaagaggcgcat
tcgattagtgccggcctcgactacccaggagtgggtccagaacacagctacctgtgtgag
attggtcgggcggagtatgccgcggttagcgatcagcaggctttggatgcattgcgcttg
gtgagtgaactagaaggaattattcctgcattagagacggcccatgcctttgcttggtta
gagacgctttgccccactcttgccgctggaacagaagtggtaatcaattgctctggccgc
ggcgataaggacgtcaacaccgtggcagagaaactgggcaatcagctttga

DBGET integrated database retrieval system